Abstract: The present invention relates to a ventilating and blanking device for a coal storage Eurosilo. The ventilating and blanking device includes a top blanking pipe, an axial flow fan and a baffle door, the top blanking pipe including a first pipeline and a second pipeline, an air supply pipe is connected to a side wall of the second pipeline, and the baffle door is connected to a driving mechanism; during blanking, the driving mechanism drives the baffle door so as to make the baffle door close the air supply pipe and the axial flow fan is shut off; and during ventilation, the driving mechanism drives the baffle door so as to make the baffle door close the first pipeline, and the axial flow fan is turned on. Compared with the prior art, the present invention has the advantages of ventilation efficiency, good ventilation effect, etc.

Abstract: A multi-orientation fingertip planar tactile feedback device includes a planar tactile feedback actuator. The planar tactile feedback actuator includes a holder and a feedback mechanism, a holding hole and an accommodating cavity are provided in the holder, one end of the holding hole penetrates through the holder, the other end is communicated with the accommodating cavity, the feedback mechanism includes a plurality of feedback parts that are arranged on cavity walls of the accommodating cavity respectively, and each feedback part includes a base, an air bag block and a baffle which are sequentially connected. A structure is simple; a finger touch force can be adjusted; five pairs of electrified coils are arranged, and force feedback vector synthesis can be performed therebetween; a direction of the force feedback generated by the electrified coil can be consistent with a direction of tactile feedback of the distal finger segment by the baffle.

Abstract: An array substrate including a display area having a plurality of subpixels is provided. The plurality of subpixels includes a plurality of first subpixels in a display-bonding sub-area and a plurality of second subpixels in a regular display sub-area. The array substrate includes a plurality of thin film transistors on a first side of the base substrate and respectively in the plurality of subpixels. A respective one of the plurality of first subpixels includes a bonding pad on a second side of a base substrate; a lead line electrically connecting a respective one of a plurality of thin film transistors to the bonding pad; and a via extending through the base substrate. The lead line is unexposed in the array substrate. The lead line extends from the first side to the second side of the base substrate through the via, to connect to the bonding pad.

Abstract: Disclosed is a near-seabed video data positioning correction method based on an ultra-short baseline, comprising the following steps: acquiring ultra-short baseline positioning data; eliminating abnormal data in the ultra-short baseline positioning data, establishing a four-dimensional elimination model, and eliminating the abnormal data in X, Y and Z directions; modeling the correction method of the recombined ultra-short baseline positioning data after removing abnormal data; obtaining the positioning data of the camera drag with specified precision by simulation. The application realizes the positioning correction of video data under the existing conditions and established operation modes, and eliminates, simulates and corrects the error data generated by the time change of ultra-short baseline data used for video positioning in the heading and other directions by integrating and using various survey data, so as to position the near-bottom video data.

Abstract: A method and system for positioning and correcting visual data by seafloor topographic profiles are provided. The method includes: offsetting the water-depth profile of the target survey line equidistantly in a grid layer of a target area to make profiles generated after the offsetting traverse the grid layer of the target area, and obtaining offset data sequences corresponding to the water-depth profile of the target survey line; drawing offset topographic profiles based on offset data of the offset data sequences corresponding to the water-depth profile of the target survey line; calculating a profile similarity between the water-depth profile of the target survey line and each of the offset topographic profiles by using a dynamic time warping (DTW) algorithm; and selecting a geographic location of one of the offset topographic profiles with a largest profile similarity as an actual geographic location of a water-depth profile of a seafloor visual survey line.

Abstract: Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X1 is selected from Y or F, and X2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.

Abstract: An intelligent identification cooking system of an oven including an image acquisition system, an image analysis and processing system, and a temperature measurement and monitoring system. The image acquisition system is connected to the image analysis and processing system and an intelligent menu control system is connected to the image analysis and processing system and the temperature measurement and monitoring system respectively. Through computer vision and identification technology and temperature sensing technology, parameters such as the type, thickness, size, fattiness and temperature are identified and automatically matched and calibrated to a cooking menu. A control program is output to a control terminal and executed.

Abstract: The invention discloses a method for rapidly predicting freezer storage time of frozen pork based on reflectance ratio of two near-infrared bands. Firstly, the near-infrared spectra information of the frozen pork is obtained by a near-infrared spectrometer, and the near-infrared spectra are analyzed to obtain center values of bands centered on 1500 nm, 1350 nm and 1890 nm characteristic peaks. The ratio thereof is treated as a eigenvector, which is substituted into the characteristic exponential function based on the eigenvector and freezer storage time to calculate the freezer storage time of frozen pork. By near-infrared spectroscopy technology, the invention directly detects the freezer storage time of pork in a frozen state, significantly reduces the time required by the conventional method, and has the advantages of being fast and non-destructive.

Abstract: Disclosed herein is a multi-temperature-region ice-temperature fresh keeping storehouse and a fresh keeping method for bergamot pears that includes a precooling region, a feeding and discharging channel, a cooling region, an ice temperature detection device, a grading device, a conveyer belt control device, an automatic storage device, and a temperature rise and fall buffering channel. The cooling region includes four freezers, with temperatures ranging from 0° C.-?3° C. The four freezers are connected level by level according to a temperature reduction rule. The present disclosure implements multi-temperature-region graded storage of bergamot pears according to the value of an ice point temperature of the bergamot pears, so that they are always stored close to the ice point temperature without freezing, thereby preventing freeze injury, and prolonging shelf life.

Abstract: A method for testing cellular level water content and distribution in fruit and vegetable tissues based on Raman spectroscopy comprises preprocessing of samples, acquisition and preprocessing of imaging spectra, Gaussian peak-separation fitting of imaging spectra, pseudocolor imaging according to the fitting results, and visualization of distribution of water content and water bonding state at the cell level. The distribution of water content and water binding state is visualized at the cellular level in the fruit and vegetable tissues for the first time, and relatively reliable quantitative analysis results of the content of water with different bonding states according to the visualization imaging results is obtained. The new method for testing cellular level water content in fruit and vegetable tissues solves the current problem of not being able to detect cellular level water changes in fruit and vegetable processing, and has a good prospect for the research on fruit and vegetables processing.

Abstract: intelligent identification cooking system of an oven including an image acquisition system, an image analysis and processing system, and a temperature measurement and monitoring system The image acquisition system is connected to the image analysis and processing system and an intelligent menu control system is connected to the image analysis and processing system and the temperature measurement and monitoring system respectively. Through computer vision and identification technology and temperature sensing technology, parameters such as the type, thickness, size, fattiness and temperature are identified and automatically matched and calibrated to a cooking menu.

Abstract: A computing system for virtual personal assistance includes technologies to, among other things, correlate an external representation of an object with a real world view of the object, display virtual elements on the external representation of the object and/or display virtual elements on the real world view of the object, to provide virtual personal assistance in a multi-step activity or another activity that involves the observation or handling of an object and a reference document.

Abstract: A multi-arm hanging rail type casting cleaning robot comprises a traveling device, a rotating device, a lifting device, a working arm mounting seat, and four working arms mounted on an annular rail, wherein in addition to pneumatic grippers and magnetic cranes, cleaning tools such as pneumatic air picks and plasma cutters are further provided on end effecters of the working arms. The traveling device of the present invention adopts a four-point hanging supporting mode to realize long-distance stable traveling. Large arm adjusting cylinders and small arm adjusting cylinders are used to replace servo reducing motors to adjust postures of the working arms. The four working arms can jointly and synchronously work. The two pneumatic grippers, the two magnetic cranes, and the four cleaning tools can be flexibly transformed and replaced. The needs of cleaning operations can be satisfied.

Abstract: An omnidirectional multi-finger asynchronous gripper for a casting robot, includes a connecting seat, an arc-shaped support, a mounting seat, longitudinal clamping devices, transverse adjusting devices and transverse clamping devices. The omnidirectional multi-finger asynchronous gripper is mounted to a tail end of the casting robot through the connecting seat; each longitudinal clamping device can independently and longitudinally clamp a casting or a mold core, is adjustable in spacing through the transverse adjusting devices, can automatically adapt to castings or mold cores with different outlines and can realize effective fitting-type adaptive clamping of specially-shaped castings and mold cores; and the transverse clamping devices are used for transversely and independently clamping the casting or mold core and a clamping position or angle can be adjusted through a swinging angle adjuster.

Abstract: The present invention relates to a method for producing fatty acids, in particular shot/medium-chain fatty acids (S/MCFA), by expression in a host cell of a recombinant fatty acid synthase (FAS) naturally devoid of a thioesterase (TE) domain comprising a heterologous thioesterase (TE). The invention further relates to polynucleotides comprising such recombinant FAS, polypeptides encoded thereby, and vectors comprising such polynucleotides, as well as recombinant host cells comprising the polynucleotides, polypeptides, or vectors.

Abstract: A method and apparatus for training and guiding users comprising generating a scene understanding based on video and audio input of a scene of a user performing a task in the scene, correlating the scene understanding with a knowledge base to produce a task understanding, comprising one or more goals, of a current activity of the user, reasoning, based on the task understanding and a user's current state, a next step for advancing the user towards completing one of the one or more goals of the task understanding and overlaying the scene with an augmented reality view comprising one or more visual and audio representation of the next step to the user.

Abstract: A multi-arm hanging rail type casting cleaning robot comprises a traveling device, a rotating device, a lifting device, a working arm mounting seat, and four working arms mounted on an annular rail, wherein in addition to pneumatic grippers and magnetic cranes, cleaning tools such as pneumatic air picks and plasma cutters are further provided on end effecters of the working arms. The traveling device of the present invention adopts a four-point hanging supporting mode to realize long-distance stable traveling. Large arm adjusting cylinders and small arm adjusting cylinders are used to replace servo reducing motors to adjust postures of the working arms. The four working arms can jointly and synchronously work. The two pneumatic grippers, the two magnetic cranes, and the four cleaning tools can be flexibly transformed and replaced. The needs of cleaning operations can be satisfied.

Abstract: An omnidirectional multi-finger asynchronous gripper for a casting robot, includes a connecting seat, an arc-shaped support, a mounting seat, longitudinal clamping devices, transverse adjusting devices and transverse clamping devices. The omnidirectional multi-finger asynchronous gripper is mounted to a tail end of the casting robot through the connecting seat; each longitudinal clamping device can independently and longitudinally clamp a casting or a mold core, is adjustable in spacing through the transverse adjusting devices, can automatically adapt to castings or mold cores with different outlines and can realize effective fitting-type adaptive clamping of specially-shaped castings and mold cores; and the transverse clamping devices are used for transversely and independently clamping the casting or mold core and a clamping position or angle can be adjusted through a swinging angle adjuster.

Abstract: A method for the preservation of fresh plants by vacuum pre-cooling synchronously combined with modified atmosphere technique includes: (1) screening field-picked fresh plants, and selecting individuals with uniform size, consistent maturity, and no obvious defects; (2) placing the screened individuals in a vacuum pre-cooler for pre-cooling; (3) after the plants are pre-cooled to the final temperature, the device automatically shuts down the refrigerator and vacuum pump, and the pre-configured mixed gas is introduced from the intake air inlet into the vacuum chamber for re-pressing; and (4) taking the re-pressed fresh plants out of the pre-cooler, and performing modified atmosphere packaging and refrigerating.