PROTOZOAN VARIANT-SPECIFIC SURFACE PROTEINS (VSP) AS CARRIERS FOR ORAL DRUG DELIVERY

The invention provides compositions for oral delivery and methods of treatment using VSP carriers, such as Giardia sp. variable surface proteins (VSP), to deliver therapeutic agents. VSP drug carriers can be combined with bioactive peptides, e.g., glucagon, or hGH, and be administered orally or mucosally. VSP carriers are resistant to acidic pHs and to proteolytic degradation and protect therapeutic agents from degradation in the gastrointestinal tract.

Skip to: Description  ·  Claims  · Patent History  ·  Patent History
Description
RELATED APPLICATIONS

This application is a continuation of U.S. application Ser. No. 14/413,189, filed Jan. 6, 2015, which issued as U.S. Pat. No. 9,757,471 on Sep. 12, 2017, which was the National Stage of International Application No. PCT/IB2013/001830, filed Jul. 5, 2013, which was a continuation in part of U.S. application Ser. No. 13/843,766, filed Mar. 15, 2013, which issued as U.S. Pat. No. 9,457,096 on Oct. 4, 2016, which claimed the benefit of U.S. Provisional Application No. 61/668,865, filed Jul. 6, 2012, all of which are incorporated herein by reference in their entireties.

REFERENCE TO SEQUENCE LISTING SUBMITTED ELECTRONICALLY

The content of the electronically submitted sequence listing in ASCII text file (Name 3181_0010003_sequence_listing_ST25.txt; Size: 2,838,875 bytes; and Date of Creation: Apr. 20, 2018) filed with the application is incorporated herein by reference in its entirety.

BACKGROUND

The present invention relates to compositions and methods to deliver therapeutic agents to a subject in need thereof using polypeptide carriers. More particularly, the present invention relates to polypeptides such as Giardia sp. variable surface proteins (VSPs) that act as carriers for the delivery of therapeutic agents such as bioactive peptides.

Oral delivery represents the ideal means of delivering prophylactic and therapeutic agents because of ease of administration, patient compliance, and cost. However, the oral route is also the most difficult because of the numerous barriers posed by the gastrointestinal tract (GIT). The main challenges are chemical and enzymatic degradation in the stomach and the upper small intestine, and lack of sufficient permeability through the stomach. Low pH in the stomach can subject therapeutic agents to physical and chemical degradation. Physical degradation of peptides generally involves modification of the native structure of a protein to a higher-order structure which may be a result of adsorption, aggregation, unfolding, precipitation, and/or complete/partial degradation to its amino acidic components. Chemical degradation usually involves blond cleavage and leads to the formation of new products.

Giardia is an intestinal pathogen which is capable of surviving the harsh environmental conditions in the stomach and the upper small intestine. Like many protozoan microorganisms, Giardia undergoes antigenic variation (see, e.g., Zambrano-Villa et al., Trends Parasitol. 18: 272-8 (2002)), a mechanism by which it continuously switches its major surface molecules allowing the parasite to evade the host's immune response and establish chronic and/or recurrent infections (see, e.g., Nash, Mol. Microbiol. 45:585-90 (2002)). These surface antigens belong to a family of Variant-specific Surface Proteins (VSPs), which are integral membrane proteins that cover the entire surface of trophozoites.

VSPs possess a cysteine-rich amino-terminal region, and a conserved carboxy-terminal domain including a transmembrane region and a short cytoplasmic tail (FIG. 1A). There is a repertoire of about 200 VSP genes in the Giardia's genome, but only one VSP is expressed on the surface of the parasite at any given time (see, e.g., Prucca et al., Nature 456(7223):750-4 (2008); Deitsch et al., Microbiol. Mol. Biol. Rev. 61:281-93 (1997)).

Since the extracellular portion of Giardia VSPs allows the parasite to survive within the hostile environment of the upper small intestine, VSPs covalently bound to antigens have been used to shuttle candidate antigens. It has been observed that when vaccines comprising VSPs covalently bound to Giardia antigens are administered orally, the vaccines fully protect animals from subsequent infections by the Giardia parasite, indicating that the antigens have survived the passage through the GIT (Rivero et al., Nat. Med. 16(5):551-7 (2010), see, e.g., PCT Pub. Nos. WP2010/064204 and WO2011/120994, which are herein incorporated by reference in their entireties).

Type 1 diabetes is usually diagnosed in children and young adults, and is responsible for a growing proportion of national health care expenditures. Type 1 diabetes is an autoimmune disease that results from a dysfunction of the immune system that attacks and destroys the ß-cells of the pancreatic islets producing insulin.

Administration of exogenous insulin is the only medication that can be used to control the increases in blood sugar that occur with the disease. Type 2 diabetes, by contrast, is characterized by defects in both insulin secretion and insulin action, with insulin deficiency usually emerging later during the course of the disease. Insulin supplementation is often required to attain good glucose levels control in this disease (see, e.g., DeWitt & Hirsch, JAMA 289:2254-2264 (2003)). There are different types of subcutaneous insulin available (Summers et al., Clin. Ther. 26:1498-1505 (2004)). However, surveys indicate substantial resistance to insulin therapy on the part of patients with type 2 diabetes due to anticipated pain and inconvenience (Peyrot et al., Diabetes Care 28:2673-2679 (2005)). The youngest and oldest patients are least likely to accept injectable therapy and thus pose the greatest challenge for physicians who want to initiate insulin treatment (Freemantle et al., Diabetes Care 28:427-428 (2005)). Consequently, efforts to develop oral, nasal, and inhaled formulations of insulin have been driven by the preference of patients to avoid subcutaneous injections (Cefalu, Ann. Med. 33:579-586 (2001); Graham et al., N. Engl. J. Med. 356:497-502 (2007)). Thus, the option of delivering insulin by the oral route remains an attractive therapeutic strategy.

Glucagon, a peptide hormone secreted by the pancreas, raises blood glucose levels. Its effect is opposite that of insulin, which lowers blood glucose levels. Glucagon is indicated and used as a treatment for severe hypoglycemia. Because patients with type 1 diabetes may have less of an increase in blood glucose levels compared with a stable type 2 patient, supplementary carbohydrates should be given as soon as possible, especially to a pediatric patient. Glucagon is also indicated as a diagnostic aid in the radiologic examination of the stomach, duodenum, small bowel, and colon when diminished intestinal motility would be advantageous. Glucagon is as effective for this examination as are the anticholinergic drugs. However, the addition of the anticholinergic agent may result in increased side effects. As in the case of insulin, the development of forms of glucagon suitable for oral delivery is an attractive therapeutic strategy.

Growth hormone deficiency is a disorder that involves the pituitary gland, which produces growth hormone and other hormones. Human growth hormone (hGH) stimulates growth and cell reproduction in humans, also exerting its action on metabolism of lipids, proteins and carbohydrates. Recombinant hGH is commonly produced by bacterial fermentation (Zeisel et al., Horm. Res. 37(Suppl 2):5-13 (1992); Sonoda & Sigimura, Biosci. Biotechnol. Biochem. 72:2675-80 (2008)). When the pituitary gland does not produce enough growth hormone, growth will be slower than normal. Growth hormone is needed for normal growth in children. In adults, growth hormone is needed to maintain the proper amounts of body fat, muscle, and bone. hGH deficiency can occur at any age. Children and some adults with growth hormone deficiency will benefit from growth hormone therapy. To treat growth hormone deficiencies, hGH (human growth hormone) is generally prescribed. hGH is an injectable drug which is injected underneath the fat of the patient's skin several times a week (Brearley et al., BMC Clin. Pharmacol. 7:10 (2007)). As in the case of insulin treatment, patient's resistance to the initiation injectable therapy and compliance pose challenges for physicians. Accordingly, the development of hGH forms suitable for oral delivery is an attractive therapeutic strategy.

BRIEF SUMMARY

The present disclosure provides compositions and methods comprising VSP-carriers for the delivery of therapeutic agents, e.g., bioactive peptides such as insulin, glucagon, or growth hormone, to a target location in a subject in need thereof, for example, via oral or mucosal administration.

More particularly, the disclosure provides the use of a VSP polypeptide, e.g., a Giardia parasite's variable surface protein (VSP) or a fragment thereof (e.g., the extracellular domain of a Giardia VSP or a CXXC motif-comprising fragment thereof) as a carrier to deliver a therapeutic agent via oral or mucosal administration. VSP carriers of the invention are not covalently bound to the therapeutic agents via peptidic bonds

Accordingly, the present disclosure provides a therapeutic composition comprising a VSP carrier and a therapeutic agent. In some embodiments, the composition is formulated for oral administration. In other embodiments, the composition is formulated for mucosal administration. In some embodiments, the VSP carrier is a VSP, a VSP-like protein, a VSP or VSP-like protein fragment, a VSP or VSP-like protein derivative, or a combination of two or more of said VSP carriers.

In some embodiments, the VSP carrier comprises a VSP from Giardia or a fragment thereof. In other embodiments, the VSP from Giardia or a fragment thereof comprises a VSP extracellular domain. In other embodiments, the VSP from Giardia is VSP1267. In some specific embodiments, the VSP carrier comprises the amino acid sequence of SEQ ID NO:2. In other embodiments, the VSP carrier further comprises a heterologous moiety. In some embodiments, the heterologous moiety is a protein purification tag sequence. In some embodiments, the protein purification tag sequence is a His6 tag. In some specific embodiments, the VSP carrier consists of the sequence of SEQ ID NO:1.

In some embodiments, the therapeutic agent is a biological agent. In some embodiments, the biological agent is a bioactive peptide. In some embodiments, the bioactive peptide is insulin, human growth hormone, glucagon, fragments, analogs, derivatives or variants thereof, or a combination of two or more of said bioactive peptides. In some embodiments, the bioactive peptide is a natural insulin. In other embodiments, the bioactive peptide is a recombinant insulin. In some embodiments, the bioactive peptide is an insulin analog. In other embodiments, the insulin analog is a fast-acting insulin. In other embodiments, the insulin analog is a long-acting insulin. In some embodiments, the fast-acting insulin is insulin Aspart. In other embodiments, the long-acting insulin is insulin Glargine.

In some embodiments, the molecule to molecule ratio of VSP carrier to the therapeutic agent ranges from about 10:1 to about 1:10. In other embodiments, the molecule to molecule ratio of VSP carrier to the therapeutic agent ranges from about 3:1 to about 1:3. In some embodiments, the molecule to molecule ratio of VSP carrier to the therapeutic agent is 3:1. In other embodiments, the molecule to molecule ratio of VSP carrier to the therapeutic agent is 1:1. In some embodiments, the composition further comprises a pharmaceutically acceptable excipient.

Also provided is a method of delivering a therapeutic agent to a target location in a subject comprising administering a therapeutic composition comprising a VSP carrier and a therapeutic agent to a subject in need thereof. The present disclosure also provides a method of treating a disease or condition in a subject comprising administering an effective amount of a therapeutic composition comprising a VSP carrier and a therapeutic agent to a subject in need thereof. In some embodiments, the disease or condition is a hormone deficiency. In some embodiments, the hormone deficiency is an insulin deficiency. In some embodiments, the insulin deficiency is type 1 diabetes.

Also provided is a method of treating a disease or condition in a subject comprising combining a VSP carrier and a therapeutic agent, where the VSP carrier binds to the therapeutic agent, and administering an effective amount of the combination of VSP carrier and therapeutic agent to the subject. The instant disclosure also provides a method of increasing the resistance of a therapeutic agent to enzymatic degradation comprising combining a VSP carrier and a therapeutic agent, where the VSP carrier can bind to the therapeutic agent, and wherein combining the VSP carrier and the therapeutic agent results in increased resistance of the therapeutic agent to enzymatic degradation.

The present disclosure also provides a method of increasing the resistance of a therapeutic agent to pH denaturation comprising combining a VSP carrier and a therapeutic agent, where the VSP carrier can bind to the therapeutic agent, and where combining the VSP carrier and the therapeutic agent results in increased resistance of the therapeutic agent to pH denaturation. Also provided is a method of increasing the attachability of a therapeutic agent to mucosal epithelial cells comprising combining a VSP carrier and a therapeutic agent, where the VSP carrier can bind to the therapeutic agent, and where combining the VSP carrier and the therapeutic agent results in increased attachability of the therapeutic to mucosal epithelial cells. In some embodiments, the mucosal epithelial cells are intestinal epithelial cells. In other embodiments, the mucosal epithelial cells are gastric epithelial cells. In some embodiments, the mucosal epithelial cells are oral epithelial cells.

Also provided is a method of making an orally deliverable composition, comprising combining a VSP carrier and a therapeutic agent, where the VSP carrier can bind to the therapeutic agent. The present disclosure also provides a method of making an injectable composition (e.g., an injectable insulin formulation) suitable for oral administration comprising combining a VSP carrier and a therapeutic agent, where the VSP carrier can bind to the therapeutic agent. For example, an injectable insulin composition can be reformulated or made suitable for oral administration by combining the injectable composition with a VSP carrier. The present disclosure also provides a method of making an injectable therapeutic agent suitable for oral administration comprising combining a VSP carrier and a therapeutic agent, where the VSP carrier can bind to the therapeutic agent. For example, an injectable insulin composition can be reformulated or made suitable for oral administration by combining the injectable composition with a VSP carrier. In some embodiments, the VSP carrier is a VSP, a VSP-like protein, a VSP or VSP-like protein fragment, a VSP or VSP-like protein derivative, or a combination of two or more of said VSP carriers. In some embodiments, the VSP carrier comprises a VSP from Giardia or a fragment thereof. In other embodiments, the VSP from Giardia or a fragment thereof comprises a VSP extracellular domain. In some embodiments, the VSP from Giardia is VSP1267. In other embodiments, the VSP carrier comprises the amino acid sequence of SEQ ID NO:2. In some embodiments, the VSP carrier further comprises a heterologous moiety. In other embodiments, the heterologous moiety is a protein purification tag sequence. In some embodiments, the protein purification tag sequence is a His6 tag. In other embodiments, the VSP carrier consists of the sequence of SEQ ID NO:1. In some embodiments, the therapeutic agent is a biological agent. In other embodiments, the biological agent is a bioactive peptide. In some embodiments, the bioactive peptide is insulin, human growth hormone, glucagon, fragments, analogs, derivatives or variants thereof, or a combination of two or more of said bioactive peptides. In some embodiments, the bioactive peptide is a natural insulin. In other embodiments, the bioactive peptide is a recombinant insulin. In some embodiments, the bioactive peptide is an insulin analog. In other embodiments, the insulin analog is a fast-acting insulin. In some embodiments, the insulin analog is a long-acting insulin. In other embodiments, the fast-acting insulin is insulin Aspart. In some other embodiments, the long-acting insulin is insulin Glargine.

BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES

FIG. 1A is a diagram showing the structural characteristics of VSPs. The diagram shows that VSPs are integral membrane proteins with a variable extracellular region rich in CXXC motifs (where C indicates a cysteine and X can be any amino acid), a unique transmembrane hydrophobic regions and a short, 5 amino acids long cytoplasmic tail.

FIG. 1B shows phase contrast (left panel) and immunofluorescence (right panel) assays showing that a group of Giardia trophozoites. Each trophozoite expresses a single VSP on its surface, which is different for each trophozoite as demonstrated by surface labeling with an anti-VSP specific monoclonal antibody.

FIG. 1C shows an anti-VSP specific immunogold labeling of the surface of a trophozoite. The entire surface of the parasite is labeled, including the ventral disk and the flagella, generating a thick surface coat.

FIG. 2A shows phase contrast (PC) images and immunofluorescent (IFA) images corresponding to two different Giardia isolates (WB and GS/M) treated with 100 μg/mL or 200 μg/mL trypsin. The monoclonal antibody G10/4 recognizes a conformational epitope in the VSPH7 VSP protein of the GS/M isolate. The monoclonal antibody 9B10 detects a non-conformational epitope in the VSP9B10 VSP protein of the WB isolate.

FIG. 2B shows phase contrast (PC) images and immunofluorescent (IFA) images corresponding to two different Giardia isolates (WB and GS/M) incubated at different pHs (1, 3, 5 and 8). The monoclonal antibody G10/4 recognizes a conformational epitope in the VSPH7 VSP protein of the GS/M isolate. The monoclonal antibody 9B10 detects a non-conformational epitope in the VSP9B10 VSP protein of the WB isolate.

FIG. 3 shows a Western blot analysis detecting the presence of three Giardia VSPs (VSP9B10, VSP1267 and VSPH7) after trophozoite trypsinization. Trophozoites were treated with trypsin at 200 μg/mL and 2 mg/mL concentrations, or incubated in medium without trypsin (control). A control sample corresponding to a mouse anti-alkaline phosphatase antibody (α-mouse) in also shown.

FIGS. 4A, 4B, and 4C show immunohistochemistry microphotographs of intestinal sections from Meriones unguiculatus (gerbils) infected with WB9B10 Giardia trophozoites (FIG. 4A), control gerbils (FIG. 4B), and gerbils to which the entire repertoire of Giardia VSPs purified from transgenic trophozoites had been orally administered (FIG. 4C) (Rivero et al., Nat. Med. 16:551-7 (2010).

FIG. 5A shows the amino acid sequence of a recombinant Giardia VSP corresponding to the extracellular portion of VSP1267 plus a C-terminal His6 tag (boxed amino acids) (SEQ ID NO:1). The N-terminal signal peptide is underlined.

FIG. 5B shows the steps of purification of recombinant VSP1267 produced in the Baculovirus system by SDS-PAGE and Western blotting using an anti-His6 monoclonal antibody.

FIG. 6 shows silver stained gels corresponding to insulins (NOVORAPID® and LANTUS®) preincubated with different concentrations of trypsin and pancreatine (a mixture of pancreatic juice components). The lane labeled MW corresponds to a molecular weight ladder. The “ins” and “trypsin” lanes are control lanes containing insulin and trypsin, respectively.

FIGS. 7A and 7B show_blood glucose levels in female Balb/c mice, 7 weeks-old, which were left without food intake for 2 hours and then received the indicated doses of insulin. FIG. 7A shows blood glucose levels after LANTUS® administration; whereas FIG. 7B shows blood glucose levels after NOVORAPID® administration. The insulins were administered orally at 1 IU, 5 IU, and 50 IU doses. PBS and a subcutaneous administration of insulin at 1-5 IU were used as controls. 1 IU seemed to be a suboptimal dose for both insulins (circled).

FIGS. 8A and 8B show blood glucose levels in female Balb/c mice, 7 weeks-old, which were left without food intake for 2 hours and then received the indicated doses of insulin, alone or combined with a VSP carrier. FIG. 8A shows blood glucose levels after LANTUS® administration; whereas FIG. 8B shows blood glucose levels after NOVORAPID® administration. The insulins were administered at the suboptimal dose identified in FIGS. 7A and 7B (1 IU) in three different formulations (i) insulin administered alone, (ii) insulin combined with VSP at a 1:1 molecule to molecule ratio, and (iii) insulin combined with VSP at a 1:3 molecule to molecule ratio. PBS and a subcutaneous administration of insulin at 1-5 IU were used as controls. The combination of 1 IU of insulin with a VSP carrier enhanced insulin's biological action, at a 1:1 insulin to VSP carrier ratio for LANTUS® and at a 1:3 insulin to VSP carrier ratio for NOVORAPID® (circled).

FIG. 9 shows the specificity of the anti-hGH monoclonal antibody (αhGH) by Western blot. Two dilutions of the monoclonal (αhGH) (1/3000 and 1/2000) were used to detect hGH (human growth hormone recombinantly produced in E. coli). A control containing an anti-alkaline phosphatase antibody (a Mouse-AP1) is also shown.

FIG. 10A shows the effect of pH on the stability of hGH. The top image is a Western blot showing the pH-mediated degradation of hGH incubated in medium at pH 1.6, 2.0, 3.8, 5.0, 5.8, 7.0, 8.0, 9.0, 10.0, and 11.0. The presence of hGH was determined using an anti-hGH monoclonal antibody. The bottom image shows the silver staining detection of hGH. Low pHs, similar to those found in the GIT, caused degradation of the protein (circles), while at higher pHs the hGH remained unaltered as compared with the control. Each lane contained 10 μg of hGH.

FIG. 10B shows the effect of combining a VSP carrier with hGH on the hGH denaturation at low pH. The Western blots correspond to pairs of samples in which hGH samples without a VSP carrier or with a VSP carrier at a 1:3 hGH to VSP carrier ratio were subjected to the same pH conditions (pH 1.4, 1.96, 3.8, 4.91, 5.9, 7.01, 7.95, 8.51, 9.61, and 11.17). The hGH:VSP carrier sample at pH 3.8 was lost during processing. The presence of hGH was determined using an anti-hGH monoclonal antibody.

FIG. 11A shows the effect of trypsin on the stability of hGH. The top image is a Western blot staining using an anti-hGH monoclonal antibody. The bottom image corresponds to silver staining. Trypsin completely proteolyzed hGH as indicated by the circled areas.

FIG. 11B shows that combining a VSP carrier with hGH at a 1:3 hGH to VSP ratio protects hGH from trypsin degradation up to 150 μg/mL trypsin. The Western blots correspond to pairs of samples in which hGH samples without a VSP carrier, or with a VSP carrier at a 1:3 hGH to VSP carrier ratio were subjected to the same trypsin concentrations (50, 100, 150, 300 and 500 μg/mL). The presence of hGH was determined using an anti-hGH monoclonal antibody.

FIG. 12A shows in its main panel the serum levels of hGH in mice after oral administration of the specified hGH doses (50, 100, 200, 400 and 800 μg). The inset shows the serum levels of hGH in mice after subcutaneous administration of a 12.5 μg dose of hGH.

FIG. 12B shows serum levels of hGH in mice after oral administration of hGH alone or in combination with a VSP carrier at a 1:3 hGH to VSP carrier ratio.

FIG. 13A shows the effect of trypsin on the stability of glucagon. The top panel of the Dot blot shows Trypsin proteolyzed glucagon. The bottom panel shows that combining a VSP carrier with glucagon at a 1:3 glucagon to VSP ratio protects glucagon from trypsin degradation up to 1:2 (protein:protease) ratio.

FIG. 13B shows the effect on blood glucose levels resulting from oral administration of glucagon alone or combined with VSP to BALC/c mice.

FIG. 14A shows the sequence of a chimeric VSP protein (SEQ ID NO: 589) derived from a VSP-like protein from Tetrahymena thermophila (SEQ ID NO: 590). The sequences encoding the signal peptide (SEQ ID NO: 591) of Giardia intestinalis VSP1267 and a His6 purification tag were respectively fused to the amino terminus and carboxy terminus of the sequence of a VSP domain (SEQ ID NO: 592) located between amino acid positions 977 and 1465 of the VSP-like protein from Tetrahymena.

FIG. 14B shows the activity of different concentration of trypsin on recombinant hGH, as detected by Western blotting using an anti-hGH monoclonal antibody.

FIG. 14C shows that combination of hGH with VSP-like protein from T. thermophila was able to protect hGH from degradation at low pH and trypsin, as demonstrated in a Coomassie Blue staining after SDS-PAGE and Western blotting using an anti-hGH monoclonal antibody.

FIG. 15A shows that the combination of IL-2 or IL-10 with a VSP was able to protect IL-2 and IL-10 from trypsin degradation, as demonstrated in a Coomassie Blue staining after SDS-PAGE.

FIG. 15B shows that the combination of IL-10 with a VSP was able to protect IL-10 from low pH-induced degradation, as demonstrated in a Coomassie Blue staining after SDS-PAGE.

FIG. 15C shows that the combination of IL-2 with a VSP was able to protect IL-2 and IL-2 from low pH-induced degradation, as demonstrated in a Coomassie Blue staining after SDS-PAGE.

DETAILED DESCRIPTION

Oral delivery of bioactive peptides such as insulin, glucagon, or growth hormone, which generally are administered via injection, offers considerable benefits in terms of decreased number of injections, improved compliance, and reduced incidence of side effects. However, successful oral delivery of therapeutic agents, e.g., bioactive peptides such as insulin, glucagon, or human growth hormone (hGH), involves overcoming the barriers of enzymatic degradation, achieving epithelial permeability, and taking steps to conserve bioactivity during the formulation process. To address this problem, we provide an oral delivery system in which bioactive peptides, e.g., insulin, glucagon, or hGH, are combined with, but not covalently combined via peptide bonds, with a VSP carrier to protect the bioactive peptides from degradation in the gastrointestinal track (GIT) and to promote its systemic biological action.

Accordingly, the present disclosure is directed to therapeutic compositions comprising VSP carriers (e.g., Giardia VSPs, VSP-like proteins, fragments, variants, or derivatives thereof) comprising at least one CXXC motif, wherein C represents a cysteine amino acid and X represents any amino acid, which can be combined and bind to therapeutic agents and function as carriers for drug delivery. The disclosure relates in particular to compositions comprising VSP carriers, e.g., polypeptides derived from the extracellular domain of Giardia VSP, which are resistant to proteases and different pHs, and which are able to attach to epithelial cells in the GIT. In some embodiments, such VSP carriers are used to form Virus-Like-Particles (VLPs) suitable to be administered orally.

The combination of therapeutic agents with VSP carriers for oral or mucosal administration confers to such therapeutic agents increased resistance to pH-induced degradation and enzymatic degradation, as well as increasing the binding of such therapeutic agents to the gastrointestinal epithelium. In some specific aspects, the therapeutics agents are bioactive peptides such as insulins, glucagon, or human growth hormone.

Definitions

It must be noted that, as used in this specification and the appended claims, the singular forms “a,” “an” and “the” include plural referents unless the context clearly dictates otherwise. The terms “a” (or “an”), as well as the terms “one or more,” and “at least one” can be used interchangeably herein.

Furthermore, “and/or” where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. Thus, the term “and/or” as used in a phrase such as “A and/or B” herein is intended to include “A and B,” “A or B,” “A,” (alone) and “B” (alone). Likewise, the term “and/or” as used in a phrase such as “A, B, and/or C” is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).

Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention is related. For example, the Concise Dictionary of Biomedicine and Molecular Biology, Juo, Pei-Show, 2nd ed., 2002, CRC Press; The Dictionary of Cell and Molecular Biology, 3rd ed., 1999, Academic Press; and the Oxford Dictionary Of Biochemistry And Molecular Biology, Revised, 2000, Oxford University Press, provide one of skill with a general dictionary of many of the terms used in this disclosure.

Units, prefixes, and symbols are denoted in their Systeme International de Unites (SI) accepted form. Numeric ranges are inclusive of the numbers defining the range. Unless otherwise indicated, amino acid sequences are written left to right in amino to carboxy orientation. The headings provided herein are not limitations of the various aspects or embodiments of the invention, which can be had by reference to the specification as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the specification in its entirety.

It is understood that wherever embodiments are described herein with the language “comprising,” otherwise analogous embodiments described in terms of “consisting of” and/or “consisting essentially of” are also provided.

Amino acids are referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, are referred to by their commonly accepted single-letter codes.

As used herein, the terms “Giardia” or “Giardia parasite” refer to a genus of anaerobic flagellated protozoan parasites of the phylum Metamonada that colonize and reproduce in the small intestines of several vertebrates, causing Giardiasis. World-wide, Giardiasis is common among people with poor fecal-oral hygiene, and major modes of transmission include contaminated water supplies or sexual activity. Flagellated Giardia trophozoites attach to epithelial cells of the small intestine (i.e., the surface of the intestinal mucosa), where they can cause disease without triggering a pronounced inflammatory response (Rivero et al., Nat. Med. 16:551-7 (2010)). There are no known virulence factors or toxins, and variable expression of surface proteins allows evasion of host immune responses and adaptation to different host environments (Rivero et al., Nat. Med. 16:551-7 (2010)). Their life cycle alternates between an actively swimming trophozoite and an infective, resistant cyst. The Giardia parasite infects humans, but is also one of the most common parasites infecting cats, dogs and birds. Mammalian hosts also include cows, beavers, deer, and sheep.

The term “Giardia” encompasses different species, including Giardia lamblia and Giardia muris. As used herein, the term “Giardia lamblia” (also called Giardia intestinalis or Giardia duodenalis) refers to one of the most common intestinal parasites of humans. Giardia lamblia is the most prevalent parasitic protist in the United States, where its incidence may be as high as 0.7% (Hlaysa et al., MMWR Surveil′. Summ. 54:9-16 (2005)).

As used herein, the terms “variable surface protein,” “VSP protein,” or “VSP” refer to polypeptides that cover the entire surface of the Giardia parasite and are the major antigens recognized by the host immune system. The term “VSP” as defined herein also includes homologs, e.g., orthologs and paralogs of “VSP” proteins from Giardia, VSP and VSP-like proteins found in other organisms, as well as fragments, variants, and derivatives thereof.

The term “homolog,” used with respect to a VSP protein or VSP-encoding gene of a first family or species, refers to distinct VSP protein or VSP-encoding genes of a second family or species which are determined by functional, structural, or genomic analyses to be an VSP protein or VSP-encoding gene of the second family or species which corresponds to the original VSP protein or VSP-encoding gene of the first family or species. As used herein, the term “homolog” refers to any VSP protein or VSP-encoding gene that is related to a reference VSP protein or VSP-encoding gene by descent from a common ancestral DNA sequence. The term homolog includes both orthologs and paralogs.

The term “ortholog” refers to VSP homologs in different species that evolved from a common ancestral gene by speciation. Typically, orthologs retain the same or similar function despite differences in their primary structure (mutations).

The term “paralog” refers to VSP homologs in the same species that evolved by genetic duplication of a common ancestral gene. In many cases, paralogs exhibit related (but not always identical functions). To the extent that a particular species has evolved multiple related genes from an ancestral DNA sequence shared with another species, the term ortholog can encompass the term paralog.

Most often, homologs will have functional, structural, or genomic similarities. Techniques are known by which homologs of an enzyme or gene can readily be cloned using genetic probes and PCR. Identity of cloned sequences as homologs can be confirmed using functional assays and/or by genomic mapping of the genes.

VSP proteins are cysteine-rich proteins with multiple CXXC motifs (where X is any amino acid) that have several particular characteristics, including in some VSP the presence of CXC motifs, a Giardia-specific Zinc-finger motif, and GGCY motifs (Nash, Mol. Microbiol. 45:585-590 (2002); Adam et al., BMC Genomics 10:424 (2010)). More precisely, VSP proteins are type 1 integral membrane proteins that vary in size from 20 to 200 kDa; possess a variable amino-terminal cysteine-rich region (extracellular domain that represents the host/parasite interface and confers to the protein resistance to proteolytic digestion and low pH), and a conserved carboxy-terminal region that includes a hydrophobic transmembrane region and a short cytosolic tail comprising only 5 amino acids (CRGKA), which are not detected by the immune system. Only one VSP protein is expressed at any given time on the surface of each parasite (Nash. Philos. Trans. R. Soc. Lond. B. Biol. Sci. 352:1369-1375 (1997)).

Within the context of the present invention, the terms “variable surface protein,” “VSP protein,” or “VSP” includes any variable surface protein of the complete repertoire of Giardia VSP proteins, notably Giardia lamblia. Actually, Giardia parasites encodes a repertoire of about 200 genes encoding VSPs for VSP assemblage A (see, e.g., Morrison et al., Science 317:1921-1926 (2010); Adam et al., BMC Genomics 10:424 (2010)), and two reports of Svard's group describing the VSP repertoire of isolates derived from VSP assemblages B and E (Jerlstrom-Hultqvist et al. BMC Genomics 11:543 (2010); Franzen et al. PLoS Pathog. 5(8):c1000560 (2009)). The extracellular domain of a VSP allows the parasite to survive the hostile environment of the upper small intestine. VSPs are very resistant to variable pHs (reactivity to a conformational epitope by a monoclonal antibody directed to a particular VSP remains unaltered between pH 2 and 12), and digestion by trypsin and several other proteases. In addition, VSPs remain attached to the enteric mucosa (Rivero et al., Nat. Med. 16(5):551-7 (2010)). A comprehensive list of VSP proteins can be found at www.ebi.ac.uk/interpro/IEntry?ac=IPR005127.

It must be further noted that polypeptides comprising at least one CXXC motif, wherein C represents a cysteine residue and X any amino acid residue, such as Giardia VSPs or VSP-like proteins of other microorganisms may also be generated in vitro by genetic manipulation and produced in heterologous systems. Therefore, chemically- or cell-produced polypeptides, including those with amino acid variations not found in the wild type parasites (for instance variants of Giardia VSPs) are encompassed. VSPs may thus be prepared by any well-known procedure in the art, such as solid phase synthesis, liquid phase synthesis or genetic engineering.

VSPs used in the therapeutic compositions of the invention can undergo chemical modifications. Chemical modifications can be aimed at obtaining VSPs with increased protection against enzymatic degradation in vivo, and/or increased capacity to cross membrane barriers, thus increasing their half-lives and maintaining or improving their biological activity. Any chemical modification known in the art can be employed according to the present invention to modify a VSP. Such chemical modifications include but are not limited to:

  • (a) modifications to the N-terminal and/or C-terminal ends of the VSP proteins such as e.g., N-terminal acylation (preferably acetylation) or desamination, or modification of the C-terminal carboxyl group into an amide or an alcohol group;
  • (b) modifications at the amide bond between two amino acids: acylation (preferably acetylation) or alkylation (preferably methylation) at the nitrogen atom or the alpha carbon of the amide bond linking two amino acids;
  • (c) modifications at the alpha carbon of the amide bond linking two amino acids such as, e.g., acylation (preferably acetylation) or alkylation (preferably methylation) at the alpha carbon of the amide bond linking two amino acids.
  • (d) chirality changes such as, e.g., replacement of one or more naturally occurring amino acids (L enantiomer) with the corresponding D-enantiomers;
  • (e) retro-inversions in which one or more naturally-occurring amino acids (L-enantiomer) are replaced with the corresponding D-enantiomers, together with an inversion of the amino acid chain (from the C-terminal end to the N-terminal end); and/or
  • (f) azapeptides wherein one or more alpha carbons are replaced with nitrogen atoms.

The terms “protein” and “polypeptide,” (e.g., a VSP protein) are used interchangeably to refer to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds). Peptides, dipeptides, tripeptides, or oligopeptides are included within the definition of “polypeptide,” and the term “polypeptide” can be used instead of, or interchangeably with any of these terms. The term “polypeptide” is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids. A polypeptide can be isolated from a natural biological source or produced by recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. A polypeptide can be generated in any manner, including by chemical synthesis.

The terms “protein” or “polypeptide” (e.g., a VSP protein) also include variants which would encompass any polypeptide comprising any natural or genetically engineered polypeptide having at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least 99% amino acid sequence identity with the sequence of the polypeptide. Variant polypeptides can be generated using genetic engineered, e.g., by insertion, substitution, deletion, or a combination thereof. Substitutions in a protein sequence of the invention can be conservative or non-conservative.

When the term “variant of a protein” applies, according to the present invention, to the Giardia VSP or VSP-like protein of other microorganisms, such variant should be able of retaining the ability to attach to cells, particularly to mucosal cells, more particularly to epithelial cells of the GIT and functioning as a therapeutic agent carrier. Variants can be naturally or non-naturally occurring. Non-naturally occurring variants can be produced using art-known mutagenesis techniques. Variant polypeptides can comprise conservative or non-conservative amino acid substitutions, deletions or additions

As used here, when the term “fragment” applies to a VSP or VSP-like protein of other microorganism (e.g., in the phrases “a fragment of a VSP” or a “VSP or a fragment thereof”) such fragment should encompass any polypeptide comprising at least about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 300, 400, or 500 contiguous or discontinuous amino acids of the protein or polypeptide as defined herein, as well as any polypeptide. Such fragment should be capable of retaining the ability to attach to cells, particularly to mucosal cell, more particularly to epithelial cells of the GIT and functioning as a therapeutic agent carrier.

“Derivatives” of polypeptides or proteins of the invention are polypeptides or proteins which have been altered so as to exhibit additional features not found on the native polypeptide or protein, but still display the beneficial properties of the parent polypeptide or protein (e.g., resistance to proteolytic enzyme degradation or binding to gastrointestinal epithelial cells).

The location of the signal sequences of the VSP protein sequences disclosed herein can be readily identified by a person skilled in the art. In addition, a skilled artisan would understand that the signal sequences in the VSP protein sequences disclosed herein can be replaced by other signal sequences known in the art. In some embodiments, additional signal sequences known in the art can be added to the VSP protein sequence disclosed herein.

A person of ordinary skill in the art, using the methods disclosed in the instant application and/or methods known in the art, would be able to generate variants, fragments, and derivatives of the VSP protein sequences disclosed herein, as well as design chimeric VSP proteins. Furthermore, a person of ordinary skill in the art, in view of the methods disclosed herein and general knowledge in the art, would be able to identify the location of functional domains enabling a protein to function as a VSP carrier in the VSP proteins disclosed herein and in their orthologs and paralogs. Also, person skilled in the art, using the methods disclosed herein and general knowledge in the art, would be able verify without undue experimentation whether VSP proteins, and their fragments, variants, or derivatives can function as VSP carriers.

An “isolated” polypeptide, protein, or a fragment, variant, or derivative thereof refers to a polypeptide or protein that is not in its natural milieu. No particular level of purification is required. For example, an isolated polypeptide or protein can simply be removed from its native or natural environment. A “recombinant” polypeptide or protein refers to a polypeptide or protein produced via recombinant DNA technology. Recombinantly produced polypeptides and proteins expressed in host cells are considered isolated for the purpose of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.

A “protein sequence” or “amino acid sequence” means a linear representation of the amino acid constituents in a polypeptide in an amino-terminal to carboxyl-terminal direction in which residues that neighbor each other in the representation are contiguous in the primary structure of the polypeptide.

A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, if an amino acid in a polypeptide is replaced with another amino acid from the same side chain family, the substitution is considered to be conservative. In another embodiment, a string of amino acids can be conservatively replaced with a structurally similar string that differs in order and/or composition of side chain family members.

The term “percent sequence identity” between two polynucleotide or polypeptide sequences refers to the number of identical matched positions shared by the sequences over a comparison window, taking into account additions or deletions (i.e., gaps) that must be introduced for optimal alignment of the two sequences. A matched position is any position where an identical nucleotide or amino acid is presented in both the target and reference sequence. Gaps presented in the target sequence are not counted since gaps are not nucleotides or amino acids. Likewise, gaps presented in the reference sequence are not counted since target sequence nucleotides or amino acids are counted, not nucleotides or amino acids from the reference sequence.

The percentage of sequence identity is calculated by determining the number of positions at which the identical amino-acid residue or nucleic acid base occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. The comparison of sequences and determination of percent sequence identity between two sequences may be accomplished using readily available software both for online use and for download. Suitable software programs are available from various sources, and for alignment of both protein and nucleotide sequences. One suitable program to determine percent sequence identity is bl2seq, part of the BLAST suite of program available from the U.S. government's National Center for Biotechnology Information BLAST web site (blast.ncbi.nlm.nih.gov). Bl2seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm. BLASTN is used to compare nucleic acid sequences, while BLASTP is used to compare amino acid sequences. Other suitable programs are, e.g., Needle, Stretcher, Water, or Matcher, part of the EMBOSS suite of bioinformatics programs and also available from the European Bioinformatics Institute (EBI) at www.ebi.ac.uk/Tools/psa.

Different regions within a single polynucleotide or polypeptide target sequence that aligns with a polynucleotide or polypeptide reference sequence can each have their own percent sequence identity. It is noted that the percent sequence identity value is rounded to the nearest tenth. For example, 80.11, 80.12, 80.13, and 80.14 are rounded down to 80.1, while 80.15, 80.16, 80.17, 80.18, and 80.19 are rounded up to 80.2. It also is noted that the length value will always be an integer.

One skilled in the art will appreciate that the generation of a sequence alignment for the calculation of a percent sequence identity is not limited to binary sequence-sequence comparisons exclusively driven by primary sequence data. Sequence alignments can be derived from multiple sequence alignments. One suitable program to generate multiple sequence alignments is ClustalW2, available from www.clustal.org. Another suitable program is MUSCLE, available from www.drive5.com/muscle/. ClustalW2 and MUSCLE are alternatively available, e.g., from the EBI.

It will also be appreciated that sequence alignments can be generated by integrating sequence data with data from heterogeneous sources such as structural data (e.g., crystallographic protein structures), functional data (e.g., location of mutations), or phylogenetic data. A suitable program that integrates heterogeneous data to generate a multiple sequence alignment is T-Coffee, available at www.tcoffee.org, and alternatively available, e.g., from the EBI. It will also be appreciated that the final alignment used to calculated percent sequence identity may be curated either automatically or manually.

The terms “heterologous moiety” mean that a polynucleotide, polypeptide, non-peptidic polymer or other moiety is derived from a distinct entity from that of the entity to which it is being compared. For instance, a heterologous polypeptide can be synthetic, or derived from a different species, different cell type of an individual, or the same or different type of cell of distinct individuals. In one aspect, a heterologous moiety can be a polypeptide fused to another polypeptide to produce a fusion polypeptide or protein. In another aspect, a heterologous moiety can be a non-polypeptide. In some embodiments, the VSP carrier comprises a heterologous moiety, e.g., a His6 tag for protein purification. In other embodiments, therapeutic agents that are combined with VSP carriers provided herein can be conjugated or fused (recombinantly, or using protein synthesis or chemical conjugation methods) to at least one heterologous moiety, e.g., polyethylene glycol (PEG), to improve a pharmacokinetic and/or pharmacodynamics property (e.g., in vivo half-life). Heterologous moieties capable of increasing the in vivo half-life of therapeutic agents are known in the art.

The term “increased” with respect to a functional characteristic of a therapeutic agent such as resistance to degradation caused by high or low pH, resistance to enzymatic degradation (e.g., proteolytic degradation), or binding to target cells (e.g., gastrointestinal epithelial cells) is used to indicate that the relevant functional characteristic is increased relative to that of a reference (for example the therapeutic agent administered in the absence of a VSP carrier), as determined under comparable conditions.

In some embodiments, the increase in the functional characteristic of the therapeutic agent (e.g., resistance to enzymatic degradation in the GIT) is, e.g., at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% higher relative to a reference (for example resistance to enzymatic degradation of the therapeutic agent, e.g., insulin, in the GIT in the absence of a VSP carrier), as determined under comparable conditions.

In some embodiments, the increase in the functional characteristic of the therapeutic agent (e.g., resistance to enzymatic degradation in the GIT) is, e.g., an at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 60-fold, at least about 70-fold, at least about 80-fold, at least about 90-fold, or at least about 100-fold increase relative to a reference (for example when compared to the resistance to enzymatic degradation of the therapeutic agent, e.g., insulin, in the GIT in the absence of a VSP carrier), as determined under comparable conditions.

The term “decreased” with respect to a functional characteristic of a therapeutic agent such as resistance to degradation caused by high or low pH, resistance to enzymatic degradation (e.g., proteolytic degradation), or binding to target cells (e.g., gastrointestinal epithelial cells) is used to indicate that the relevant functional characteristic is decreased relative to that of a reference (for example the therapeutic agent administered in the absence of a VSP carrier), as determined under comparable conditions.

In some embodiments, the decrease in the functional characteristic of the therapeutic agent (e.g., resistance to enzymatic degradation in the GIT) is, e.g., at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% lower relative to a reference (for example resistance to enzymatic degradation of the therapeutic agent, e.g., insulin, in the GIT in the presence of a VSP carrier), as determined under comparable conditions.

In some embodiments, the decrease in the functional characteristic of the therapeutic agent (e.g., resistance to enzymatic degradation in the GIT) is, e.g., at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 60-fold, at least about 70-fold, at least about 80-fold, at least about 90-fold, or at least about 100-fold lower relative to a reference (for example when compared to the resistance to enzymatic degradation of the therapeutic agent, e.g., insulin, in the GIT in the presence of a VSP carrier), as determined under comparable conditions.

The term “polynucleotide” or “nucleotide” is intended to encompass a singular nucleic acid as well as plural nucleic acids, and refers to an isolated nucleic acid molecule or construct, e.g., messenger RNA (mRNA) or plasmid DNA (pDNA). In certain embodiments, a polynucleotide comprises a conventional phosphodiester bond or a non-conventional bond (e.g., an amide bond, such as found in peptide nucleic acids (PNA)).

The term “nucleic acid” refers to any one or more nucleic acid segments, e.g., DNA or RNA fragments, present in a polynucleotide. By “isolated” nucleic acid or polynucleotide is intended a nucleic acid molecule, DNA or RNA, which has been removed from its native environment. For example, a recombinant polynucleotide encoding a VSP polypeptide contained in a vector is considered isolated for the purposes of the present invention. Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) from other polynucleotides in a solution. Isolated RNA molecules include in vivo or in vitro RNA transcripts of polynucleotides of the present invention. Isolated polynucleotides or nucleic acids according to the present invention further include such molecules produced synthetically. In addition, a polynucleotide or a nucleic acid can include regulatory elements such as promoters, enhancers, ribosome binding sites, or transcription termination signals.

As used herein, a “coding region” or “coding sequence” is a portion of polynucleotide which consists of codons translatable into amino acids. Although a “stop codon” (TAG, TGA, or TAA) is typically not translated into an amino acid, it may be considered to be part of a coding region, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, introns, and the like, are not part of a coding region. The boundaries of a coding region are typically determined by a start codon at the 5′ terminus, encoding the amino terminus of the resultant polypeptide, and a translation stop codon at the 3′ terminus, encoding the carboxyl terminus of the resulting polypeptide. Two or more coding regions of the present invention can be present in a single polynucleotide construct, e.g., on a single vector, or in separate polynucleotide constructs, e.g., on separate (different) vectors. It follows, then, that a single vector can contain just a single coding region, or comprise two or more coding regions, e.g., a single vector can separately encode a binding domain-A and a binding domain-B as described below. In addition, a vector, polynucleotide, or nucleic acid of the invention can encode heterologous coding regions, either fused or unfused to a nucleic acid encoding a binding domain of the invention. Heterologous coding regions include without limitation specialized elements or motifs, such as a secretory signal peptide or a heterologous moiety (e.g., a His6 tag).

Certain proteins secreted by eukaryotic cells are associated with a secretory signal peptide which is cleaved from the mature protein once export of the growing protein chain across the rough endoplasmic reticulum has been initiated. Those of ordinary skill in the art are aware that signal peptides are generally fused to the N-terminus of the polypeptide, and are cleaved from the complete or “full-length” polypeptide to produce a secreted or “mature” form of the polypeptide. In certain embodiments, a native signal peptide is used, or a functional derivative of that sequence that retains the ability to direct the secretion of the polypeptide that is operably associated with it. Alternatively, a heterologous signal peptide, e.g., a human tissue plasminogen activator (TPA) or mouse ß-glucuronidase signal peptide, or a functional derivative thereof, can be used.

As used herein, the term “host cell” refers to a cell or a population of cells harboring or capable of harboring a recombinant nucleic acid. Host cells can be a prokaryotic cells (e.g., E. coli), or alternatively, the host cells can be eukaryotic, for example, fungal cells (e.g., yeast cells such as Saccharomyces cerevesiae, Pichia pastoris, or Schizosaccharomyces pombe), and various animal cells, such as insect cells (e.g., Sf-9) or mammalian cells (e.g., HEK293F, CHO, COS-7, NIH-3T3).

The term “therapeutic agent” refers to any therapeutically active substance that is delivered to a subject, e.g., orally, to produce a desired beneficial effect such as preventing, inhibiting, or arresting the symptoms and/or progression of a disease or condition. In some embodiments, a therapeutic agent can be preformulated, e.g., as a microcapsule, microsphere, microbubble, liposome, nisome, emulsion, dispersion, etc., before it is combined with the VSP carrier. Also included in the definition of therapeutic agent are diagnostically active agents and imaging agents such as dyes or fluorescent markers.

As used herein, the term “pharmaceutically acceptable” means approved by a regulatory agency of U.S. or E.U. or other government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in humans. Hence, the term “pharmaceutically acceptable” refers to those properties and/or substances that are acceptable to a patient (e.g., a human patient) from a toxicological and/or safety point of view.

The terms “pharmaceutically acceptable excipient” and “pharmaceutically acceptable carrier” refer to excipients and carriers used in pharmaceutical compositions which do not have a significant detrimental impact on the treated host and which retain the therapeutic properties of the therapeutic agent with which it they are administered. One exemplary physiologically acceptable carrier is physiological saline. Other physiologically acceptable carriers and their formulations are known to one skilled in the art and are described, for example, in Remington's Pharmaceutical Sciences, (18th edition), ed. A. Gennaro, 1990, Mack Publishing Company, Easton, Pa., incorporated herein by reference.

The phrase “effective amount” as used herein refers to that amount of a therapeutic composition of the invention, comprising a combination of a therapeutic agent with a VSP carrier, or a pharmaceutical composition comprising such therapeutic composition which is effective for producing a desired effect, at a reasonable benefit/risk ratio applicable to any medical treatment. For example, an “effective amount” is an amount effective to reduce or lessen at least one symptom of the disease or disorder being treated or to reduce or delay onset of one or more clinical markers or symptoms associated with the disease or disorder, or to modify or reverse the disease process.

The terms “treat” or “treatment” as used herein refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder in a subject, such as the progression of an hormone deficiency-related disease or condition. Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.

The term “treatment” also means prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.

The term “administering,” as used herein, means to give a therapeutic composition of the invention comprising a therapeutic agent combined with a VSP carrier, or pharmaceutical composition comprising the therapeutic composition of the invention, to a subject (e.g., human subject) in need thereof via a pharmaceutically acceptable route of administration. In some embodiments, the route of administration is oral or mucosal. In other embodiments, the route of administration is selected from subcutaneous, intramuscular, nasal, intravenous, and pulmonary administration. A VSP carrier can be administered as part of a pharmaceutical composition comprising at least one therapeutic agent and at least one pharmaceutically acceptable excipient.

The terms “subject” and “patient” are used interchangeably and refer to any individual, patient or animal, in particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired. Mammalian subjects include humans, domestic animals, farm animals, and zoo, sports, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, etc.

Introduction

This disclosure provides therapeutic compositions comprising a VSP carrier and a therapeutic agent. VSP carriers are polypeptides such as variant-specific surface proteins (VSPs) of the intestinal parasite Giardia lamblia and VSP-like proteins from other organisms which can bind to therapeutic agents, e.g., bioactive peptides, and effectively deliver such therapeutic agents by the oral or mucosal route. To determine whether VSPs, due to their resistance to degradation by acidic pH, resistance to proteolytic degradation, and adherence to the intestinal mucosa, can effectively be combined with therapeutic agents (e.g., bioactive peptide) and be used as carriers to transport therapeutic agents through the gastro intestinal tract (GIT), we have used three bioactive peptides, insulin, glucagon, and human growth hormone, as prototype therapeutic agents to be delivered by the oral route.

The results disclosed herein in the Examples section indicate that VSP carriers can be used to effectively deliver therapeutic agents orally, or by other delivery routes (e.g., mucosal administration) where proteolytic degradation and/or exposure to low pH could affect the integrity of the therapeutic agent.

The term “VSP carrier” as used herein refers to a VSP protein (e.g., a Giardia VSP, a VSP-like protein, a VSP or VSP-like protein fragment, a VSP or VSP-like protein variant, a VSP or VSP-like protein derivative, or a combination of two or more of said VSP polypeptides) which can bind to at least one therapeutic agent. In certain embodiments, the at least one therapeutic agent is not a vaccine immunogen.

In some embodiments, the VSP carrier is a “chimeric VSP.” As used herein, the term “chimeric VSP” refers to an engineered VSP protein comprising protein subsequences derived from different VSP proteins. In some embodiments, the subsequences are obtained from VSP proteins from the same species. In other embodiments, the subsequences are obtained from VSP proteins from different species. In some embodiments, the chimeric VSP protein comprises non-VSP elements, for example, purification tags (e.g., a His6 or other purification tag known in the art), detectable tags (e.g., fluorescent or radioactive tags known in the art), etc. For example, a chimeric VSP protein can contain a subsequence comprising a VSP domain from a first VSP protein (e.g., a VSP protein from Giardia) and the signal sequence from a different protein (e.g., a second VSP protein from Giardia). In other embodiments, a chimeric VSP protein can contain a subsequence comprising a VSP domain from a first VSP protein from a first species (e.g., a VSP protein from Tetrahymena thermophila) and the signal sequence of a different VSP protein from a second species (e.g., a signal peptide from Giardia). In some embodiments, a chimeric VSP can comprise more than one VSP domain. In some embodiments, a chimeric VSP can comprise a VSP domain comprising subdomains (e.g., one or more furin-like cysteine-rich domains, or one or more epidermal growth factor-like domains) from different VSP proteins, which can be from the same species or from different species.

The location of VSP domains in a VSP protein can be readily identified using computational tools known in the art. For example, a protein sequence can be scanned to identify subsequences containing PFAM domain model PFAM03302 (Giardia variant-specific surface protein). The program InterproScan can also be used to scan a candidate protein for matches against the INTERPRO collection of protein signature databases, in particular, for the presence of model IPRO05127 (Giardia variant-specific surface protein). A skilled artisan would understand that the boundaries of a VSP domain subsequences selected to be included in a chimeric VSP do not need to match exactly the boundaries reported by computational tools such as InterproScan. Accordingly, a person skilled in the art, using the methods disclosed herein and general knowledge in the art would be able to modify the boundaries of a VSP domain identified computationally and verify without undue experimentation whether the resulting VSP domain fragment can indeed function as a VSP carrier. Also, a person skill in the art would be able to identify the location of peptide signal sequences to use as components in chimeric VSPs by using publicly available tools, for example, the SignalP program available at www.cbs.dtu.dk/services/SignalP. For example, the SignalP program can be used to identify the location of signal peptides in the VSP and VSP-like proteins included in TABLE 1 or in other proteins identified as containing a VSP domain based on the presence of models PFAM03302 and/or IPRO05125 in their amino acid sequences.

In some cases, a natural VSP may be too large for successful recombinant expression, its expression level in cell cultures may be too low, or the large size may hinder purification or the production of stable formulations. Accordingly, the present disclosure provides a method to generate a VSP carrier comprising excising a VSP domain from a large candidate VSP protein. In some embodiments, amino acids are added and/or removed from the carboxy and/or amino termini of the excised VSP domain in order to optimize desirable properties, e.g., expression level, expression yield, purification yield, stability in solution, formulation stability, resistance to proteases, pH stability, thermal stability, attachability to GIT membranes, ability to bind to therapeutic agents, etc.

The VSP carriers of the invention are not covalently bound to the therapeutic agents via peptidic bonds. Thus, the term “bound” and its grammatical variants (e.g., “bind,” “binds,” “binding,” etc.) when applied to the interaction between a VSP carrier and a therapeutic agent refers to (i) covalent non-peptide binding (e.g., binding via a disulphide bond) or (ii) non-covalent binding, but not to peptide-bond formation between the VSP carrier and a therapeutic agent.

Non-limiting examples of non-covalent binding between a VSP carrier and a therapeutic agent include an ionic bond (e.g., cation-pi bond or salt bond), a metal bond, an hydrogen bond (e.g., dihydrogen bond, dihydrogen complex, low-barrier hydrogen bond, or symmetric hydrogen bond), van der Waals force, London dispersion force, a mechanical bond, a halogen bond, aurophilicity, intercalation, stacking, entropic force, or chemical polarity.

The term “bound” also refers to enclosing, or partially enclosing a therapeutic agent (e.g., a bioactive peptide such as insulin) by a molecular structure that comprises a VSP carrier. In some embodiments, the term “bound” refers to the interaction (covalent or non-covalent) of a VSP carrier with a macromolecular structure in which a therapeutic agent is enclosed. In this respect, the therapeutic agent can be enclosed or packaged, e.g., in a lipid bilayer, liposome, nanoparticle, nanotube, nanobubble, micelle, nanosphere, nanoshell, nanorod, chemical cage, nanohorn, quantum dot, nanocluster, microbubble, dendrimer, aquasome, lipopolyplex, nanoemulsion, or a combination thereof. The term “bound” also includes binding of a VSP carrier to a lipid bilayer or insertion of a VSP carrier into a lipid bilayer which either comprises the therapeutic agent (e.g., a liposoluble drug inserted in the bilayer's hydrophobic core) or encloses the therapeutic agent (e.g., the lipid bilayer is part of a liposome in which the therapeutic agent is packaged).

In some embodiments, the VSP carrier comprises a heterologous moiety genetically fused to a hydrophobic peptide that anchors the VSP carrier the bilayer. In other embodiments, a heterologous moiety that anchors the VSP carrier to the bilayer (e.g., a hydrophobic peptide or a lipid anchor) can be chemically conjugated to the VSP carrier. In some embodiments, the VSP carrier can be genetically fused or conjugated to a heterologous moiety by a linker. The term “linker” refers to a molecular entity that covalently links a VSP carrier and a heterologous moiety. The linker can comprises, for example, a thiol group, an alkyl group, a glycol group, or a peptide group. Linkers include cross-linking molecules. See, e.g., Int. Pat. Publ. No. WO 2004/009116, which is incorporated herein by reference in its entirety.

In some embodiments, the VSP carrier is bound to the therapeutic agent by forming a “virus-like particle” (VLP) that comprises the therapeutic agent (either on the surface of the VLP or encapsulated in the VLP). As used herein, the term “virus-like particle” or “VLP” refers to a structure resembling a virus particle that displays a Giardia VSP or a fragment thereof at its surface. A virus-like particle in accordance with the present invention is non-replicative since it lacks all or part of a viral genome, typically and preferably lacking all or part of the replicative and infectious components of a viral genome. The term “non-replicative” as used herein refers to being incapable of replicating the genome comprised or not in the VLP.

As used herein, the term “combine” (and grammatical variants such as “combined” or “combining”) refers to the process of admixing two or more components (e.g., a VSP carrier and a therapeutic agent) such that contact between the components occur and such contact allows the binding of the two or more components.

In some specific embodiments, a therapeutic agent (e.g., a bioactive peptide such as IL-2) can be genetically fused to a VSP protein (see, e.g., preliminary experiments disclosed in the first paragraph of Example 9). In specific embodiments, the therapeutic agent is a bioactive peptide (e.g., insulin, glucagon, growth hormone) in a nanoparticle form which is chemically conjugated to a VSP. In some embodiments, a therapeutic agent (e.g., a bioactive peptide) is chemically conjugated to a VSP without any linker interposed between the therapeutic agent and the linker. In some embodiments, a therapeutic agent (e.g., a bioactive peptide) is chemically conjugated to a VSP with at least one linker interposed between the therapeutic agent and the VSP.

In some embodiments, a VSP carrier can be chemically conjugated with more than one therapeutic agent (e.g., more than one bioactive peptide). In some embodiments, two or more VSP carriers can be chemically conjugated with one therapeutic agent (e.g., a bioactive peptide). In other embodiments, two or more than two VSP carriers can be chemically conjugated with more than one therapeutic agent (e.g., more than one bioactive peptide). In some embodiments, a therapeutic agent is biologically active while genetically fused or chemically conjugated to a VSP carrier. In other embodiments, the therapeutic agent (e.g., a bioactive peptide) is inactive or only partially active while genetically fused or chemically conjugated to a VSP carrier, in which case, chemical and/or enzymatic cleavage can be required to release the active (or a more active) form of the therapeutic agent. Conversely, in some embodiments, the therapeutic agent (e.g., a bioactive peptide) is active while genetically fused or chemically conjugated to a VSP carrier, and chemical and/or enzymatic cleavage can be used to release the active form of the therapeutic agent from the VSP carrier in order to inactivate the therapeutic agent. Thus, a therapeutic agent (e.g., a bioactive peptide) could be protected by the VSP carrier while in a part of the GIT (e.g., the stomach), and degraded or inactivated after passage to a different part of the GIT by the different conditions prevalent in that portion of the GIT (e.g., different pH or specific enzymes).

In some embodiments, a therapeutic agent (e.g., a bioactive peptide) and a VSP carrier can be genetically fused or chemically conjugated by a peptide linker or other type of linker that can be cleaved (e.g., chemically or by a protease) such as the active form of the therapeutic peptide is released from the VSP carrier. In some embodiments, a therapeutic agent (e.g., a bioactive peptide) and a VSP carrier can be genetically fused or chemically conjugated by a peptide linker or other type of linker that can be cleaved (e.g., chemically or by a protease) such as the inactive form of the therapeutic agent is released from the VSP carrier.

In some embodiments, a therapeutic agent (e.g., a bioactive peptide) and a VSP carrier (bound, genetically fused, or chemically conjugated) can be bound, genetically fused, or chemically conjugated with another molecule to form a bivalent molecule (for example, both the VSP carrier and the therapeutic agent being genetically fused to the carboxy terminus of the beta chain of C4b-binding protein (C4PB)).

VSP Carriers from Giardia VSPs

In some embodiments, the VSP carrier comprises a VSP sequence chosen among the complete repertoire of VSPs that are encoded at the DNA level in the genome of the Giardia parasite. This repertoire is composed of about 200 homologous VSP-encoding genes (vsps), which varies in different Giardia isolates (see, Adam et al., BMC Genomics 11:424 (2010)). It should be further noted that variants of the Giardia VSPs, fragments, and derivatives can also be used as VSP carriers according to the invention. A representative, non-limiting list of proteins that can be used as VSP carriers is presented in TABLE 1.

TABLE 1 Exemplary list of VSP and VSP-like proteins that can be used as VSP carriers. SEQ UNIPROT ID NO IDENTIFIER SPECIES 7 A0BQN4_PARTE Paramecium tetraurelia 8 A0BR77_PARTE Paramecium tetraurelia 9 A0D0W7_PARTE Paramecium tetraurelia 10 A2E569_TRIVA Trichomonas vaginalis 11 A2EKF7_TRIVA Trichomonas vaginalis 12 A6YSN6_GIAIN Giardia intestinalis 13 A7SVH3_NEMVE Nematostella vectensis 14 A8B1N7_GIAIC Giardia intestinalis 15 A8B1Y1_GIAIC Giardia intestinalis 16 A8B2D7_GIAIC Giardia intestinalis 17 A8B2E6_GIAIC Giardia intestinalis 18 A8B2P0_GIAIC Giardia intestinalis 19 A8B2X6_GIAIC Giardia intestinalis 20 A8B2Y3_GIAIC Giardia intestinalis 21 A8B3P1_GIAIC Giardia intestinalis 22 A8B3R3_GIAIC Giardia intestinalis 23 A8B3V9_GIAIC Giardia intestinalis 24 A8B497_GIAIC Giardia intestinalis 25 A8B4C6_GIAIC Giardia intestinalis 26 A8B4J7_GIAIC Giardia intestinalis 27 A8B4K3_GIAIC Giardia intestinalis 28 A8B4K7_GIAIC Giardia intestinalis 29 A8B4P3_GIAIC Giardia intestinalis 30 A8B4S6_GIAIC Giardia intestinalis 31 A8B4Y0_GIAIC Giardia intestinalis 32 A8B4Y3_GIAIC Giardia intestinalis 33 A8B582_GIAIC Giardia intestinalis 34 A8B5B4_GIAIC Giardia intestinalis 35 A8B5M7_GIAIC Giardia intestinalis 36 A8B5M8_GIAIC Giardia intestinalis 37 A8B5P6_GIAIC Giardia intestinalis 38 A8B5Q2_GIAIC Giardia intestinalis 39 A8B5U7_GIAIC Giardia intestinalis 40 A8B5U8_GIAIC Giardia intestinalis 41 A8B6C8_GIAIC Giardia intestinalis 42 A8B6F0_GIAIC Giardia intestinalis 43 A8B6G2_GIAIC Giardia intestinalis 44 A8B6J1_GIAIC Giardia intestinalis 45 A8B6V3_GIAIC Giardia intestinalis 46 A8B728_GIAIC Giardia intestinalis 47 A8B7F5_GIAIC Giardia intestinalis 48 A8B7F8_GIAIC Giardia intestinalis 49 A8B7K8_GIAIC Giardia intestinalis 50 A8B7T7_GIAIC Giardia intestinalis 51 A8B838_GIAIC Giardia intestinalis 52 A8B8E0_GIAIC Giardia intestinalis 53 A8B8R6_GIAIC Giardia intestinalis 54 A8B8Y3_GIAIC Giardia intestinalis 55 A8B9G0_GIAIC Giardia intestinalis 56 A8B9Q8_GIAIC Giardia intestinalis 57 A8B9R0_GIAIC Giardia intestinalis 58 A8BA10_GIAIC Giardia intestinalis 59 A8BA87_GIAIC Giardia intestinalis 60 A8BAG1_GIAIC Giardia intestinalis 61 A8BAG4_GIAIC Giardia intestinalis 62 A8BAI1_GIAIC Giardia intestinalis 63 A8BAX4_GIAIC Giardia intestinalis 64 A8BB06_GIAIC Giardia intestinalis 65 A8BB29_GIAIC Giardia intestinalis 66 A8BB81_GIAIC Giardia intestinalis 67 A8BBE8_GIAIC Giardia intestinalis 68 A8BBH5_GIAIC Giardia intestinalis 69 A8BBP7_GIAIC Giardia intestinalis 70 A8BBQ0_GIAIC Giardia intestinalis 71 A8BBQ1_GIAIC Giardia intestinalis 72 A8BBR6_GIAIC Giardia intestinalis 73 A8BBX7_GIAIC Giardia intestinalis 74 A8BC24_GIAIC Giardia intestinalis 75 A8BC41_GIAIC Giardia intestinalis 76 A8BCN1_GIAIC Giardia intestinalis 77 A8BCU7_GIAIC Giardia intestinalis 78 A8BCV1_GIAIC Giardia intestinalis 79 A8BCV5_GIAIC Giardia intestinalis 80 A8BCV8_GIAIC Giardia intestinalis 81 A8BCW0_GIAIC Giardia intestinalis 82 A8BCW5_GIAIC Giardia intestinalis 83 A8BD73_GIAIC Giardia intestinalis 84 A8BD76_GIAIC Giardia intestinalis 85 A8BDC4_GIAIC Giardia intestinalis 86 A8BDH4_GIAIC Giardia intestinalis 87 A8BDM0_GIAIC Giardia intestinalis 88 A8BDP5_GIAIC Giardia intestinalis 89 A8BEA2_GIAIC Giardia intestinalis 90 A8BEA7_GIAIC Giardia intestinalis 91 A8BEJ8_GIAIC Giardia intestinalis 92 A8BEQ4_GIAIC Giardia intestinalis 93 A8BET9_GIAIC Giardia intestinalis 94 A8BEU2_GIAIC Giardia intestinalis 95 A8BEV3_GIAIC Giardia intestinalis 96 A8BFA0_GIAIC Giardia intestinalis 97 A8BFC1_GIAIC Giardia intestinalis 98 A8BFJ7_GIAIC Giardia intestinalis 99 A8BFK4_GIAIC Giardia intestinalis 100 A8BFY9_GIAIC Giardia intestinalis 101 A8BFZ3_GIAIC Giardia intestinalis 102 A8BG61_GIAIC Giardia intestinalis 103 A8BGA3_GIAIC Giardia intestinalis 104 A8BH77_GIAIC Giardia intestinalis 105 A8BH92_GIAIC Giardia intestinalis 106 A8BHI3_GIAIC Giardia intestinalis 107 A8BHL4_GIAIC Giardia intestinalis 108 A8BHY9_GIAIC Giardia intestinalis 109 A8BJ28_GIAIC Giardia intestinalis 110 A8BJM0_GIAIC Giardia intestinalis 111 A8BJT8_GIAIC Giardia intestinalis 112 A8BJU0_GIAIC Giardia intestinalis 113 A8BJU2_GIAIC Giardia intestinalis 114 A8BK37_GIAIC Giardia intestinalis 115 A8BK84_GIAIC Giardia intestinalis 116 A8BLI8_GIAIC Giardia intestinalis 117 A8BLR0_GIAIC Giardia intestinalis 118 A8BLZ5_GIAIC Giardia intestinalis 119 A8BM49_GIAIC Giardia intestinalis 120 A8BM52_GIAIC Giardia intestinalis 121 A8BM73_GIAIC Giardia intestinalis 122 A8BME9_GIAIC Giardia intestinalis 123 A8BMY2_GIAIC Giardia intestinalis 124 A8BN71_GIAIC Giardia intestinalis 125 A8BNR0_GIAIC Giardia intestinalis 126 A8BNR1_GIAIC Giardia intestinalis 127 A8BNR4_GIAIC Giardia intestinalis 128 A8BNZ3_GIAIC Giardia intestinalis 129 A8BNZ4_GIAIC Giardia intestinalis 130 A8BP21_GIAIC Giardia intestinalis 131 A8BPL3_GIAIC Giardia intestinalis 132 A8BPN5_GIAIC Giardia intestinalis 133 A8BPN6_GIAIC Giardia intestinalis 134 A8BPP1_GIAIC Giardia intestinalis 135 A8BPP4_GIAIC Giardia intestinalis 136 A8BPP7_GIAIC Giardia intestinalis 137 A8BQ05_GIAIC Giardia intestinalis 138 A8BQ57_GIAIC Giardia intestinalis 139 A8BQ73_GIAIC Giardia intestinalis 140 A8BQD0_GIAIC Giardia intestinalis 141 A8BQD1_GIAIC Giardia intestinalis 142 A8BQM2_GIAIC Giardia intestinalis 143 A8BQM3_GIAIC Giardia intestinalis 144 A8BQN8_GIAIC Giardia intestinalis 145 A8BQX2_GIAIC Giardia intestinalis 146 A8BQX8_GIAIC Giardia intestinalis 147 A8BRF5_GIAIC Giardia intestinalis 148 A8BRK4_GIAIC Giardia intestinalis 149 A8BRR2_GIAIC Giardia intestinalis 150 A8BRR9_GIAIC Giardia intestinalis 151 A8BRS4_GIAIC Giardia intestinalis 152 A8BRY1_GIAIC Giardia intestinalis 153 A8BS16_GIAIC Giardia intestinalis 154 A8BS49_GIAIC Giardia intestinalis 155 A8BS56_GIAIC Giardia intestinalis 156 A8BSC1_GIAIC Giardia intestinalis 157 A8BSY8_GIAIC Giardia intestinalis 158 A8BT57_GIAIC Giardia intestinalis 159 A8BTL5_GIAIC Giardia intestinalis 160 A8BTQ7_GIAIC Giardia intestinalis 161 A8BTR0_GIAIC Giardia intestinalis 162 A8BTS2_GIAIC Giardia intestinalis 163 A8BTV4_GIAIC Giardia intestinalis 164 A8BTV5_GIAIC Giardia intestinalis 165 A8BTZ8_GIAIC Giardia intestinalis 166 A8BUT4_GIAIC Giardia intestinalis 167 A8BUU6_GIAIC Giardia intestinalis 168 A8BV34_GIAIC Giardia intestinalis 169 A8BV90_GIAIC Giardia intestinalis 170 A8BVA8_GIAIC Giardia intestinalis 171 A8BVH9_GIAIC Giardia intestinalis 172 A8BVM8_GIAIC Giardia intestinalis 173 A8BVQ2_GIAIC Giardia intestinalis 174 A8BVU8_GIAIC Giardia intestinalis 175 A8BVV3_GIAIC Giardia intestinalis 176 A8BVX4_GIAIC Giardia intestinalis 177 A8BVZ5_GIAIC Giardia intestinalis 178 A8BWB7_GIAIC Giardia intestinalis 179 A8BWQ1_GIAIC Giardia intestinalis 180 A8BXF2_GIAIC Giardia intestinalis 181 A8BXV1_GIAIC Giardia intestinalis 182 A8BY81_GIAIC Giardia intestinalis 183 A8BY91_GIAIC Giardia intestinalis 184 A8BYJ1_GIAIC Giardia intestinalis 185 A8BYM1_GIAIC Giardia intestinalis 186 A8BZ11_GIAIC Giardia intestinalis 187 A8BZ19_GIAIC Giardia intestinalis 188 A8BZM3_GIAIC Giardia intestinalis 189 A8C008_GIAIC Giardia intestinalis 190 A8C017_GIAIC Giardia intestinalis 191 A8C020_GIAIC Giardia intestinalis 192 A8C025_GIAIC Giardia intestinalis 193 A8C028_GIAIC Giardia intestinalis 194 A8C039_GIAIC Giardia intestinalis 195 A8C046_GIAIC Giardia intestinalis 196 A8C048_GIAIC Giardia intestinalis 197 A8C081_GIAIC Giardia intestinalis 198 A8C085_GIAIC Giardia intestinalis 199 A8C088_GIAIC Giardia intestinalis 200 A8C091_GIAIC Giardia intestinalis 201 A8C094_GIAIC Giardia intestinalis 202 A8C0A1_GIAIC Giardia intestinalis 203 A8C0A4_GIAIC Giardia intestinalis 204 A8C0A9_GIAIC Giardia intestinalis 205 A8C0B7_GIAIC Giardia intestinalis 206 A8C0C3_GIAIC Giardia intestinalis 207 A8C0D1_GIAIC Giardia intestinalis 208 A8C0E0_GIAIC Giardia intestinalis 209 A8C0F1_GIAIC Giardia intestinalis 210 A8C0F4_GIAIC Giardia intestinalis 211 A8C0G2_GIAIC Giardia intestinalis 212 A8C0H0_GIAIC Giardia intestinalis 213 A8C0I3_GIAIC Giardia intestinalis 214 A8C0J1_GIAIC Giardia intestinalis 215 A8C0L4_GIAIC Giardia intestinalis 216 A8C0N5_GIAIC Giardia intestinalis 217 A8C0N9_GIAIC Giardia intestinalis 218 A8C0R2_GIAIC Giardia intestinalis 219 A8C0U5_GIAIC Giardia intestinalis 220 A8C0V5_GIAIC Giardia intestinalis 221 A8C0W0_GIAIC Giardia intestinalis 222 A8C109_GIAIC Giardia intestinalis 223 B0EAK2_ENTDS Entamoeba dispar 224 B0EU80_ENTDS Entamoeba dispar 225 B1N5Q9_ENTHI Entamoeba histolytica 226 C4M6P7_ENTHI Entamoeba histolytica 227 C4MAB2_ENTHI Entamoeba histolytica 228 C6LMQ7_GIAIB Giardia intestinalis 229 C6LMR0_GIAIB Giardia intestinalis 230 C6LMY7_GIAIB Giardia intestinalis 231 C6LN95_GIAIB Giardia intestinalis 232 C6LND2_GIAIB Giardia intestinalis 233 C6LNK7_GIAIB Giardia intestinalis 234 C6LNL8_GIAIB Giardia intestinalis 235 C6LNP8_GIAIB Giardia intestinalis 236 C6LNT8_GIAIB Giardia intestinalis 237 C6LPA7_GIAIB Giardia intestinalis 238 C6LPF5_GIAIB Giardia intestinalis 239 C6LPK7_GIAIB Giardia intestinalis 240 C6LPM5_GIAIB Giardia intestinalis 241 C6LQL2_GIAIB Giardia intestinalis 242 C6LR62_GIAIB Giardia intestinalis 243 C6LR84_GIAIB Giardia intestinalis 244 C6LRD7_GIAIB Giardia intestinalis 245 C6LSQ1_GIAIB Giardia intestinalis 246 C6LT09_GIAIB Giardia intestinalis 247 C6LT91_GIAIB Giardia intestinalis 248 C6LTI3_GIAIB Giardia intestinalis 249 C6LTI4_GIAIB Giardia intestinalis 250 C6LUA9_GIAIB Giardia intestinalis 251 C6LUN4_GIAIB Giardia intestinalis 252 C6LV02_GIAIB Giardia intestinalis 253 C6LV68_GIAIB Giardia intestinalis 254 C6LVB6_GIAIB Giardia intestinalis 255 C6LVG2_GIAIB Giardia intestinalis 256 C6LVI0_GIAIB Giardia intestinalis 257 C6LVL2_GIAIB Giardia intestinalis 258 C6LVZ6_GIAIB Giardia intestinalis 259 C6LW79_GIAIB Giardia intestinalis 260 C6LW95_GIAIB Giardia intestinalis 261 C6LW96_GIAIB Giardia intestinalis 262 C6LWD6_GIAIB Giardia intestinalis 263 C6LWL1_GIAIB Giardia intestinalis 264 C6LWM7_GIAIB Giardia intestinalis 265 C6LWN2_GIAIB Giardia intestinalis 266 C6LWN3_GIAIB Giardia intestinalis 267 C6LWN4_GIAIB Giardia intestinalis 268 C6LWQ8_GIAIB Giardia intestinalis 269 C6LX19_GIAIB Giardia intestinalis 270 C6LX20_GIAIB Giardia intestinalis 271 C6LXE3_GIAIB Giardia intestinalis 272 C6LXG6_GIAIB Giardia intestinalis 273 C6LXK0_GIAIB Giardia intestinalis 274 C6LYE5_GIAIB Giardia intestinalis 275 C6M071_GIAIB Giardia intestinalis 276 C6M0C1_GIAIB Giardia intestinalis 277 D3KID0_GIAIC Giardia intestinalis 278 D3KID3_GIAIC Giardia intestinalis 279 E1EVI9_GIAIA Giardia intestinalis 280 E1EVN5_GIAIA Giardia intestinalis 281 E1EVS1_GIAIA Giardia intestinalis 282 E1EVS6_GIAIA Giardia intestinalis 283 E1EVZ6_GIAIA Giardia intestinalis 284 E1EW20_GIAIA Giardia intestinalis 285 E1EW38_GIAIA Giardia intestinalis 286 E1EW69_GIAIA Giardia intestinalis 287 E1EWA1_GIAIA Giardia intestinalis 288 E1EWG3_GIAIA Giardia intestinalis 289 E1EWG5_GIAIA Giardia intestinalis 290 E1EWJ7_GIAIA Giardia intestinalis 291 E1EWL5_GIAIA Giardia intestinalis 292 E1EWV5_GIAIA Giardia intestinalis 293 E1EX39_GIAIA Giardia intestinalis 294 E1EX68_GIAIA Giardia intestinalis 295 E1EX83_GIAIA Giardia intestinalis 296 E1EX85_GIAIA Giardia intestinalis 297 E1EX98_GIAIA Giardia intestinalis 298 E1EXE5_GIAIA Giardia intestinalis 299 E1EXF3_GIAIA Giardia intestinalis 300 E1EXH8_GIAIA Giardia intestinalis 301 E1EXH9_GIAIA Giardia intestinalis 302 E1EXL8_GIAIA Giardia intestinalis 303 E1EXQ8_GIAIA Giardia intestinalis 304 E1EXV3_GIAIA Giardia intestinalis 305 E1EXV4_GIAIA Giardia intestinalis 306 E1EXY2_GIAIA Giardia intestinalis 307 E1EYP5_GIAIA Giardia intestinalis 308 E1EYT9_GIAIA Giardia intestinalis 309 E1EYU0_GIAIA Giardia intestinalis 310 E1EZ23_GIAIA Giardia intestinalis 311 E1EZ44_GIAIA Giardia intestinalis 312 E1EZ63_GIAIA Giardia intestinalis 313 E1EZD7_GIAIA Giardia intestinalis 314 E1EZF7_GIAIA Giardia intestinalis 315 E1EZI4_GIAIA Giardia intestinalis 316 E1EZI5_GIAIA Giardia intestinalis 317 E1EZR7_GIAIA Giardia intestinalis 318 E1EZR8_GIAIA Giardia intestinalis 319 E1EZZ8_GIAIA Giardia intestinalis 320 E1F044_GIAIA Giardia intestinalis 321 E1F046_GIAIA Giardia intestinalis 322 E1F0C0_GIAIA Giardia intestinalis 323 E1F0K6_GIAIA Giardia intestinalis 324 E1F0M1_GIAIA Giardia intestinalis 325 E1F0M8_GIAIA Giardia intestinalis 326 E1F0M9_GIAIA Giardia intestinalis 327 E1F0N0_GIAIA Giardia intestinalis 328 E1F0N3_GIAIA Giardia intestinalis 329 E1F0P7_GIAIA Giardia intestinalis 330 E1F0T4_GIAIA Giardia intestinalis 331 E1F129_GIAIA Giardia intestinalis 332 E1F130_GIAIA Giardia intestinalis 333 E1F1D1_GIAIA Giardia intestinalis 334 E1F1F5_GIAIA Giardia intestinalis 335 E1F1J9_GIAIA Giardia intestinalis 336 E1F1K4_GIAIA Giardia intestinalis 337 E1F1S0_GIAIA Giardia intestinalis 338 E1F1U0_GIAIA Giardia intestinalis 339 E1F1Y3_GIAIA Giardia intestinalis 340 E1F1Y4_GIAIA Giardia intestinalis 341 E1F1Z6_GIAIA Giardia intestinalis 342 E1F213_GIAIA Giardia intestinalis 343 E1F225_GIAIA Giardia intestinalis 344 E1F249_GIAIA Giardia intestinalis 345 E1F2E8_GIAIA Giardia intestinalis 346 E1F2L4_GIAIA Giardia intestinalis 347 E1F2Q5_GIAIA Giardia intestinalis 348 E1F2S0_GIAIA Giardia intestinalis 349 E1F2V4_GIAIA Giardia intestinalis 350 E1F2Z8_GIAIA Giardia intestinalis 351 E1F326_GIAIA Giardia intestinalis 352 E1F373_GIAIA Giardia intestinalis 353 E1F3A2_GIAIA Giardia intestinalis 354 E1F3D7_GIAIA Giardia intestinalis 355 E1F3H3_GIAIA Giardia intestinalis 356 E1F3M4_GIAIA Giardia intestinalis 357 E1F3S1_GIAIA Giardia intestinalis 358 E1F3U6_GIAIA Giardia intestinalis 359 E1F3X6_GIAIA Giardia intestinalis 360 E1F3X7_GIAIA Giardia intestinalis 361 E1F428_GIAIA Giardia intestinalis 362 E1F447_GIAIA Giardia intestinalis 363 E1F459_GIAIA Giardia intestinalis 364 E1F477_GIAIA Giardia intestinalis 365 E1F478_GIAIA Giardia intestinalis 366 E1F4C2_GIAIA Giardia intestinalis 367 E1F4C3_GIAIA Giardia intestinalis 368 E1F4G3_GIAIA Giardia intestinalis 369 E1F4G6_GIAIA Giardia intestinalis 370 E1F4L3_GIAIA Giardia intestinalis 371 E1F4L5_GIAIA Giardia intestinalis 372 E1F4N7_GIAIA Giardia intestinalis 373 E1F4N8_GIAIA Giardia intestinalis 374 E1F4N9_GIAIA Giardia intestinalis 375 E1F4X0_GIAIA Giardia intestinalis 376 E1F562_GIAIA Giardia intestinalis 377 E1F591_GIAIA Giardia intestinalis 378 E1F598_GIAIA Giardia intestinalis 379 E1F5C1_GIAIA Giardia intestinalis 380 E1F5E4_GIAIA Giardia intestinalis 381 E1F5I0_GIAIA Giardia intestinalis 382 E1F5N4_GIAIA Giardia intestinalis 383 E1F5N5_GIAIA Giardia intestinalis 384 E1F5Q7_GIAIA Giardia intestinalis 385 E1F5Q8_GIAIA Giardia intestinalis 386 E1F5R1_GIAIA Giardia intestinalis 387 E1F5S2_GIAIA Giardia intestinalis 388 E1F5W0_GIAIA Giardia intestinalis 389 E1F5W1_GIAIA Giardia intestinalis 390 E1F5X3_GIAIA Giardia intestinalis 391 E1F5Y9_GIAIA Giardia intestinalis 392 E1F5Z9_GIAIA Giardia intestinalis 393 E1F623_GIAIA Giardia intestinalis 394 E1F663_GIAIA Giardia intestinalis 395 E1F667_GIAIA Giardia intestinalis 396 E1F670_GIAIA Giardia intestinalis 397 E1F685_GIAIA Giardia intestinalis 398 E1F6C5_GIAIA Giardia intestinalis 399 E1F6G2_GIAIA Giardia intestinalis 400 E1F6H9_GIAIA Giardia intestinalis 401 E1F6I0_GIAIA Giardia intestinalis 402 E1F6L8_GIAIA Giardia intestinalis 403 E1F6M3_GIAIA Giardia intestinalis 404 E1F6Q9_GIAIA Giardia intestinalis 405 E1F6T5_GIAIA Giardia intestinalis 406 E1F6V8_GIAIA Giardia intestinalis 407 E1F727_GIAIA Giardia intestinalis 408 E1F734_GIAIA Giardia intestinalis 409 E1F771_GIAIA Giardia intestinalis 410 E1F772_GIAIA Giardia intestinalis 411 E1F797_GIAIA Giardia intestinalis 412 E1F7B5_GIAIA Giardia intestinalis 413 E1F7B6_GIAIA Giardia intestinalis 414 E1F7D7_GIAIA Giardia intestinalis 415 E1F7F9_GIAIA Giardia intestinalis 416 E1F7P6_GIAIA Giardia intestinalis 417 E1F7U6_GIAIA Giardia intestinalis 418 E1F7W8_GIAIA Giardia intestinalis 419 E1F7X0_GIAIA Giardia intestinalis 420 E1F7X8_GIAIA Giardia intestinalis 421 E1F7Z9_GIAIA Giardia intestinalis 422 E1F856_GIAIA Giardia intestinalis 423 E1F891_GIAIA Giardia intestinalis 424 E1F8E1_GIAIA Giardia intestinalis 425 E1F8F3_GIAIA Giardia intestinalis 426 E1F8K1_GIAIA Giardia intestinalis 427 E1F8M3_GIAIA Giardia intestinalis 428 E1F8N7_GIAIA Giardia intestinalis 429 E1F8N8_GIAIA Giardia intestinalis 430 E1F8P0_GIAIA Giardia intestinalis 431 E1F8P4_GIAIA Giardia intestinalis 432 E1F8Q3_GIAIA Giardia intestinalis 433 E1F8Q5_GIAIA Giardia intestinalis 434 E1F8Q9_GIAIA Giardia intestinalis 435 E1F8S0_GIAIA Giardia intestinalis 436 E1F8S1_GIAIA Giardia intestinalis 437 E1F8U6_GIAIA Giardia intestinalis 438 E1F8U7_GIAIA Giardia intestinalis 439 E1F8V9_GIAIA Giardia intestinalis 440 E1F8W0_GIAIA Giardia intestinalis 441 E1F8W3_GIAIA Giardia intestinalis 442 E1F8Y1_GIAIA Giardia intestinalis 443 E1F8Z1_GIAIA Giardia intestinalis 444 E1F917_GIAIA Giardia intestinalis 445 E1F930_GIAIA Giardia intestinalis 446 E1F954_GIAIA Giardia intestinalis 447 E1F987_GIAIA Giardia intestinalis 448 E1F9D3_GIAIA Giardia intestinalis 449 E1F9D5_GIAIA Giardia intestinalis 450 E1F9E4_GIAIA Giardia intestinalis 451 E1F9F7_GIAIA Giardia intestinalis 452 E1F9H3_GIAIA Giardia intestinalis 453 E1F9I2_GIAIA Giardia intestinalis 454 E1F9I5_GIAIA Giardia intestinalis 455 E1F9J0_GIAIA Giardia intestinalis 456 E1F9J2_GIAIA Giardia intestinalis 457 E1F9L1_GIAIA Giardia intestinalis 458 E1F9M5_GIAIA Giardia intestinalis 459 E1F9M9_GIAIA Giardia intestinalis 460 E1F9N1_GIAIA Giardia intestinalis 461 E1F9N2_GIAIA Giardia intestinalis 462 E1F9Q7_GIAIA Giardia intestinalis 463 E1F9R4_GIAIA Giardia intestinalis 464 E1F9R6_GIAIA Giardia intestinalis 465 E1F9U1_GIAIA Giardia intestinalis 466 E2RTM9_GIAIN Giardia intestinalis 467 E2RTN8_GIAIC Giardia intestinalis 468 E2RTU6_GIAIC Giardia intestinalis 469 E2RTV3_GIAIC Giardia intestinalis 470 E2RTX4_GIAIC Giardia intestinalis 471 E2RU01_GIAIC Giardia intestinalis 472 E2RU12_GIAIC Giardia intestinalis 473 E2RU28_GIAIC Giardia intestinalis 474 E2RU34_GIAIC Giardia intestinalis 475 E2RU43_GIAIC Giardia intestinalis 476 E2RU54_GIAIC Giardia intestinalis 477 E5EZ44_GIAIN Giardia intestinalis 478 E5EZ45_GIAIN Giardia intestinalis 479 E5EZ46_GIAIN Giardia intestinalis 480 E5EZ47_GIAIN Giardia intestinalis 481 G0QQQ1_ICHMG Ichthyophthirius multifiliis 482 G0QTU6_ICHMG Ichthyophthirius multifiliis 483 O97443_GIAIN Giardia intestinalis 484 O97444_GIAIN Giardia intestinalis 485 O97448_GIAIN Giardia intestinalis 486 O97450_GIAIN Giardia intestinalis 487 TSA4_GIAIN Giardia intestinalis 488 VS41_GIAIN Giardia intestinalis 489 TS11_GIAIN Giardia intestinalis 490 Q07317_GIAIN Giardia intestinalis 491 Q0R0E0_GIAIN Giardia intestinalis 492 Q22M55_TETTS Tetrahymena thermophila 493 Q234X6_TETTS Tetrahymena thermophila 494 Q24959_GIAIN Giardia intestinalis 495 Q24960_GIAIN Giardia intestinalis 496 Q24962_GIAIN Giardia intestinalis 497 Q24970_GIAIN Giardia intestinalis 498 Q24971_GIAIN Giardia intestinalis 499 Q24977_GIAIN Giardia intestinalis 500 Q24986_GIAIN Giardia intestinalis 501 Q24987_GIAIN Giardia intestinalis 502 Q24988_GIAIN Giardia intestinalis 503 Q24990_GIAIN Giardia intestinalis 504 Q24992_GIAIN Giardia intestinalis 505 Q38QK0_GIAIN Giardia intestinalis 506 Q49L26_GIAMU Giardia muris 507 Q49L27_GIAMU Giardia muris 508 Q49L28_GIAMU Giardia muris 509 Q49L29_GIAMU Giardia muris 510 Q49L30_GIAMU Giardia muris 511 Q49L31_GIAMU Giardia muris 512 Q4RPQ0_TETNG Tetraodon nigroviridis 513 Q7JNB5_GIAIN Giardia intestinalis 514 Q7M3R4_GIAIN Giardia intestinalis 515 Q8I0M3_GIAIN Giardia intestinalis 516 Q8I0P4_GIAIN Giardia intestinalis 517 Q8I8V1_GIAIN Giardia intestinalis 518 Q8I8V2_GIAIN Giardia intestinalis 519 Q8I8V3_GIAIN Giardia intestinalis 520 Q8I8V4_GIAIN Giardia intestinalis 521 Q8I8V5_GIAIN Giardia intestinalis 522 Q8I8V6_GIAIN Giardia intestinalis 523 Q8I8V7_GIAIN Giardia intestinalis 524 Q8I8V8_GIAIN Giardia intestinalis 525 Q8I8V9_GIAIN Giardia intestinalis 526 Q8I8W0_GIAIN Giardia intestinalis 527 Q8I8W1_GIAIN Giardia intestinalis 528 Q8I8W2_GIAIN Giardia intestinalis 529 Q8I8W3_GIAIN Giardia intestinalis 530 Q8I8W4_GIAIN Giardia intestinalis 531 Q8I8W6_GIAIN Giardia intestinalis 532 Q8MPM6_GIAIN Giardia intestinalis 533 Q95PT9_GIAIN Giardia intestinalis 534 Q95WU1_GIAIN Giardia intestinalis 535 Q967R8_GIAIN Giardia intestinalis 536 Q967R9_GIAIN Giardia intestinalis 537 Q9BH65_GIAIN Giardia intestinalis 538 Q9BIJ8_GIAIN Giardia intestinalis 539 Q9BIJ9_GIAIN Giardia intestinalis 540 Q9BIK0_GIAIN Giardia intestinalis 541 Q9BIK1_GIAIN Giardia intestinalis 542 Q9BIK2_GIAIN Giardia intestinalis 543 Q9BIK3_GIAIN Giardia intestinalis 544 Q9BIK4_GIAIN Giardia intestinalis 545 Q9BIK5_GIAIN Giardia intestinalis 546 Q9BIK6_GIAIN Giardia intestinalis 547 Q9BIK7_GIAIN Giardia intestinalis 548 Q9BIK8_GIAIN Giardia intestinalis 549 Q9BIK9_GIAIN Giardia intestinalis 550 Q9BIL0_GIAIN Giardia intestinalis 551 Q9BIL1_GIAIN Giardia intestinalis 552 Q9BIL2_GIAIN Giardia intestinalis 553 Q9BIL3_GIAIN Giardia intestinalis 554 Q9BIL4_GIAIN Giardia intestinalis 555 Q9BIL5_GIAIN Giardia intestinalis 556 Q9BIL6_GIAIN Giardia intestinalis 557 Q9BIL7_GIAIN Giardia intestinalis 558 Q9BIL8_GIAIN Giardia intestinalis 559 Q9BIL9_GIAIN Giardia intestinalis 560 Q9BIM0_GIAIN Giardia intestinalis 561 Q9BIM1_GIAIN Giardia intestinalis 562 Q9BIM2_GIAIN Giardia intestinalis 563 Q9BIM3_GIAIN Giardia intestinalis 564 Q9GQ40_GIAIN Giardia intestinalis 565 Q9GQ41_GIAIN Giardia intestinalis 566 Q9GQ42_GIAIN Giardia intestinalis 567 Q9GQ43_GIAIN Giardia intestinalis 568 Q9GQ44_GIAIN Giardia intestinalis 569 Q9GQ45_GIAIN Giardia intestinalis 570 Q9GQ46_GIAIN Giardia intestinalis 571 Q9GQ47_GIAIN Giardia intestinalis 572 Q9GS24_GIAIN Giardia intestinalis 573 Q9GSP6_GIAIN Giardia intestinalis 574 Q9NGL3_GIAIN Giardia intestinalis 575 Q9NGZ3_GIAIN Giardia intestinalis 576 Q9NGZ6_GIAIN Giardia intestinalis 577 Q9NGZ7_GIAIN Giardia intestinalis 578 Q9NH87_GIAIN Giardia intestinalis 579 Q9U013_GIAIN Giardia intestinalis 580 Q9U018_GIAIN Giardia intestinalis 581 Q9U019_GIAIN Giardia intestinalis 582 Q9U021_GIAIN Giardia intestinalis 583 Q9U048_GIAIN Giardia intestinalis 584 Q9U063_GIAIN Giardia intestinalis 585 Q9U064_GIAIN Giardia intestinalis 586 Q9XTJ7_GIAIN Giardia intestinalis 587 Q9XTK3_GIAIN Giardia intestinalis 588 Q9XY90_GIAIN Giardia intestinalis

TABLE 1 includes the sequences of 585 VSP and VSP-like proteins comprising Interpro Giardia variant-specific surface protein motif IPR005127 (sequence list published online at embl-ebi.org/interpro/IEntry?ac=IPR005127 and publicly available on Jun. 12, 2012). Other VSP and VSP-like proteins that can be used as VSP carriers according to the present disclosure are the 1,079 protein sequences comprising the Giardia variant-specific surface protein motif PF03302 available at Version 26.0 of the Pfam database (sequence list published online at pfam.sanger.ac.uk/family/PF03302 and publicly available on Jun. 12, 2012). The lists of protein sequences published in the above cited databases and publicly available on the above disclosed dates are herein incorporated by reference in their entireties.

As above-mentioned, the Giardia VSPs and more particularly the extracellular domain of the Giardia VSPs comprise multiple CXXC motifs, preferably multiple CXXC motifs separated by several amino acids, from 3 to 20 amino acids and more particularly from 5 to 8 amino acids (as observed by multiple sequence alignments). Thus, in some embodiments, the VSP carrier is a fragment, analog or derivative of a VSP or VSP-like protein from Giardia, wherein the VSP carrier comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 CXXC motifs. In some embodiments, the VSP carrier comprises at least about 40, at least about 50, at least about 60, at least about 70, at least 80, about 90 or at least about 100 CXXC motifs from a Giardia VSP.

In a particular embodiment, the Giardia parasite is Giardia lamblia. In one embodiment, the Giardia VSP can be without limitation VSP9B10 (Uniprot:Q9GS24), VSP1267 (Uniprot: Q07317), VSPA6 (Uniprot: Q24970), VSPS1 (Uniprot: Q8I0P4), VSPS2 (Uniprot:Q8I8W6), VSPS3 (Uniprot:Q8I0M3), VSPS4 (Uniprot: E2RTM9), VSPS5 (Uniprot:Q8I8W4), VSPS6 (Uniprot:Q8I8W3), VSPS7 (Uniprot:Q8I8W2), VSPS8 (Uniprot:E2RTU6), VSPAS1 (Uniprot:Q8I0M3), VSPAS2 (Uniprot:8I8W0), VSPAS3 (Uniprot:Q8I8V9), VSPAS4 (Uniprot:Q8I0P4), VSPAS5 (Uniprot:Q8I8V8), VSPAS6 (Uniprot:Q8I8V7), VSPAS7 (Uniprot:Q8I8V6), VSPAS8 (Uniprot:Q8I8V5), VSPAS9 (Uniprot: Q8I8V4), VSPAS10 (Uniprot: Q8I8V3), VSPAS11 (Uniprot: Q8I8V2), VSPAS12 (Uniprot:E2RU01) or VSPH7 (Uniprot: Q24992) of Giardia lamblia, or fragments, variants, or derivatives thereof.

In one embodiment, a VSP carrier comprises the extracellular domain of a Giardia VSP, or a fragment, variant or derivative thereof (since said extracellular domain is the amino-terminal cysteine rich region comprising multiple CXXC motifs of the Giardia VSP protein).

The extracellular domain of a Giardia VSP is the domain resistant to the pH, temperature and proteolytic digestion. Accordingly, in another embodiment, the VSP carrier according to the invention comprises only the extracellular domain of a Giardia VSP, or a fragment, variant, or derivative thereof. In a particular embodiment, the VSP carrier comprises the extracellular sequence of VSP1267 (SEQ ID NO:2), comprising the N-terminal signal peptide. The transmembrane region and the cytoplasmic tail of a Giardia VSP are thus eliminated. It should be noted that the peptide signal can also be removed from the VSP extracellular domain.

A list of VSP and VSP-like proteins suitable to generate VSP carriers, including their sequences, Uniprot Accession Numbers, and Uniprot Entry Names is included at the end of this specification. The correspondence between Uniprot Accession Nos. and Entry Names and VSP protein number can be determined from the Uniprot entry at www.uniprot.org. E.g., Uniprot Accession No. Q07317 and its Entry Name Q07317_GIAIN would correspond to VSP1267.

The term “VSP1267 carrier” refers to a recombinantly produced fragment of the Giardia VSP protein VSP1267 without the transmembrane domain and cytosolic tail, but with the signal peptide intact and further comprising a C-terminal His6 tag (SEQ ID NO:1, shown in FIG. 5A). In some embodiments, a VSP carrier is a fragment, variant, or derivative of the extracellular domain of VSP1267 (protein sequence is SEQ ID NO:2; DNA coding sequence is SEQ ID NO: 4). In other embodiments, a VSP carrier is a fragment, variant, or VSP9B10 (protein sequence is SEQ ID NO:3; DNA coding sequence is SEQ ID NO: 5). See TABLE 2.

TABLE 2  Protein and DNA Sequences of exemplary VSP carriers.  Variant-specific surface protein (VSP) 1267  Giardia lamblia  (without transmembrane domain and cytosolic tail) EMBL AAA29159.1 Protein Sequence (signal peptide is underlined) (SEQ ID NO: 2)  MLLIAFYLILSTFAVDCKNSGNSCEAGQCDTIGDTEICMQCNQGKVPINGICTAHSEEAVTNAGCKKNG  GTNIEESDKVCGQCGNGYFLHKGGCYKIGEAPGNLICADEASNPGARTAGVCGACKDGYYKNSDAVATA  DSCIACEDANCATCGGAGENKCTKCIDGYFVGATGNEGGCIKCDATTGPNSYKGVAGCAKCEKPKNAGP  AKCIECAADYLKTEADEQTSCVSEAVCREGKTHFPTTDSAGGNKKVCVSCGTTNNGGIENCGECTSKES  AARAGTEITCTKCSSNNLSPLGDACLTDCPAGTYAVSGDSGSVCKPCHNTCAGCQTDDRETSCTACSPG  YSLLYESNGATGRCVKECTGAFITNCADGQCTANVGGAKYCTQCKDGYAPIDGICTAVAAAGRDVSVCT  ATGGKCTACTGNYALLSGGCYNTQTLPGKSVCKAVANSNDGKCKTCANGQAPDPATNFCPLCDSTCAEC  STKNDADACTKCFPGYYKTGNKCIKCTESSNNGKKIDGIPDCLSCEAPINTGPAICYVKTDGTSDENSG  NGGDSTNKSGLST  DNA Sequence (sequence encoding the signal peptide is underlined) (SEQ ID NO: 4)  ATGTTGTTGATAGCCTTCTATCTTATATTATCTACATTTGCAGTAGATTGCAAGAATAGTGGAAATAGT  TGTGAAGCTGGCCAATGTGATACGATTGGCGATACTGAAATCTGTATGCAATGTAATCAAGGGAAAGTA  CCCATCAATGGAATATGTACAGCCCATAGTGAAGAAGCAGTCACTAACGCTGGTTGTAAGAAGAACGGG  GGTACTAATATAGAAGAAAGTGATAAGGTATGTGGACAATGTGGAAATGGCTACTTCCTGCACAAAGGC  GGATGCTATAAGATAGGAGAGGCTCCTGGCAATCTCATCTGTGCGGATGAGGCGTCAAATCCTGGTGCA  CGTACTGCAGGGGTGTGTGGTGCTTGCAAGGATGGCTATTATAAGAATTCGGATGCTGTTGCAACTGCA  GACTCCTGTATAGCATGTGAAGATGCCAACTGTGCCACATGTGGAGGAGCTGGTGAAAACAAATGTACA  AAATGTATAGACGGATACTTTGTTGGAGCAACTGGAAATGAAGGTGGGTGCATAAAATGTGACGCTACC  ACAGGGCCTAATAGCTACAAAGGAGTTGCTGGATGTGCTAAATGTGAAAAGCCAAAGAACGCTGGTCCT  GCAAAGTGCATTGAATGTGCTGCTGATTATTTGAAAACAGAAGCAGATGAACAAACGTCTTGCGTTAGC  GAAGCCGTGTGCAGAGAAGGCAAGACGCACTTCCCCACTACTGACAGCGCTGGTGGTAACAAGAAGGTA  TGCGTAAGTTGTGGCACAACGAATAATGGCGGCATAGAAAACTGTGGAGAATGCACCTCTAAGGAAAGC  GCTGCACGGGCAGGGACAGAGATCACCTGCACCAAATGCTCTAGCAATAATCTGAGCCCCCTGGGAGAC  GCGTGTCTAACAGACTGCCCTGCCGGAACGTATGCCGTTAGTGGCGACAGCGGCAGTGTCTGCAAGCCC  TGTCACAACACGTGCGCCGGCTGCCAGACCGACGACAGGGAGACTTCCTGCACGGCCTGCTcCCCTGGA  TACTCCCTTCTGTATGAGTCCAACGGAGCAACTGGGAGGTGCGTCAAGGAGTGCACTGGTGCGTTCATT  ACCAACTGTGCGGACGGGCAGTGCACGGCTAACGTCGGGGGTGCGAAGTACTGCACCCAGTGCAAGGAC  GGGTACGCCCCGATCGACGGGATCTGTACAGCGGTGGCAGCTGCCGGGAGAGACGTGAGCGTGTGCACG  GCCACAGGTGGCAAGTGCACGGCATGTACAGGCAACTATGCGTTATTATCAGGTGGATGTTATAACACA  CAAACACTTCCTGGAAAGTCAGTATGTAAAGCCGTGGCTAATAGCAATGACGGGAAATGCAAAACATGT  GCCAATGGTCAAGCACCAGATCCTGCTACTAATTTCTGCCCATTGTGTGATTCAACTTGTGCAGAATGT  TCAACTAAAAATGATGCTGATGCTTGTACAAAATGTTTTCCAGGATACTATAAAACAGGAAATAAGTGT  ATCAAATGTACAGAAAGTAGTAATAACGGAAAAAAGATCGATGGAATACCTGATTGTTTAAGTTGTGAA  GCACCGATTAATACTGGTCCTGcCATCTGCTACGTTAAAACGGATGGCACTAGCGATGATAACAGCGGC  AATGGTGGAGACAGCACCAACAAGAGCGGCCTTTCCACTGGC  Variant-specific surface  Giardia lamblia) EMBL AAK97086.1  protein (VSP) WB/9B10-B  Protein Sequence (SEQ ID NO: 3)  MFGSFVLAGVLVQIAWAGKATERAAQCADNTNCAFEACNVLIGGKLYCSRCNTGFVPINGQCADKEGAT  DQCKDGSGGDTADQTCGQCAEQTFMYKGGCYEAAQQPGQTMCQAADAGVCTQAAQGYFVPPGADASHQS  VIPCGDEEGITVKNDKKYKGVLHCTRCYAPTEAADANAKAATCTACGDSKIVKTAKDSATSCVTEEECT  GTKTCKTCAEGTSDGCATCEKGADGAVACKTCGSNKKVQPNKKGCIAKCPETVSAEKDGVCECVEGYVP  DNAGTGCTKKPDPQCNTPGCKTCSEPKTSKEVCTECEDPKALTPTGQCIYGCEHLEGYYEGTSEGGKKA  CKKCEVENCLLCNGQGQCETCKDGYYKSGAACAKCNTSCKTCANGNSNGCTSCEPKQVLSYEGEGTGTC  KPGCKPVSGGKDGTCKSCDLNIDGTSYCSACNVGTEYPENGVCVKKSARTASCQAEPSNGVCGTCARGF  FRMNGGCYETTKLPGKSVCEEVASAGDTCQTPADGYKLNNGALITCSAGCKTCTSQDQCDTCKAGYAKT  GGNTKKCVPCATGCSECNADDATKCTVCAAGYYLSKEKCIACDKSDGGSITGVANCANCAPPTNNKGPV  LCYLIQNTNRSGLSTG  DNA Sequence (SEQ ID NO: 5)  ATGTTTGGCAGTTTTGTTCTCGCGGGGGTACTCGTCCAGATTGCATGGGCAGGAAAAGCAACAGAGCGC  GCGGCTCAATGCGCAGATAACACTAATTGCGCAGAGGAAGCATGCAACGTTCTGATCGGTGGTAAATTG  TATTGCTCTCGATGTAACACAGGATTTGTTCCTATCAATGGACAATGTGCAGACAAAGAAGGTGCAACA  GATCAGTGCAAAGATGGCTCCGGAGGCGATACAGCTGATCAGACCTGTGGACAGTGCGCCGAGCAGACT  TTCATGTACAAGGGCGGCTGTTACGAAGCAGCCCAGCAGCCCGGACAGACCATGTGTCAGGCGGCAGAT  GCTGGAGTATGCACACAAGCCGCGCAAGGATACTTCGTGCCGCCGGGCGCAGACGCCTCTCACCAATCG  GTCATACCATGCGGAGACGAAGAGGGAATAACAGTTAAGAACGATAAAAAGTACAAGGGCGTGCTGCAC  TGCACTCGGTGTTACGCTCCCACAGAAGCAGCAGATGCTAACGCCAAGGCCGCCACGTGTACTGCGTGC  GGCGATAGCAAGATCGTCAAGACAGCCAAGGACTCAGCCACCTCCTGCGTGACAGAAGAAGAGTGCACC  GGCACCAAGACGTGCAAGACGTGCGCCGAGGGGACCTCCGACGGGTGTGCGACGTGCGAGAAGGGCGCC  GATGGAGCAGTCGCCTGCAAGACGTGCGGGTCTAATAAGAAGGTCCAGCCAAACAAGAAGGGGTGCATA  GCAAAGTGCCCGGAGACGGTGAGTGCCGAGAAGGATGGCGTTTGTGAGTGCGTCGAGGGCTACGTTCCC  GACAACGCGGGCACCGGGTGCACGAAGAAGCCCGACCCCCAGTGCAACACCCCCGGCTGCAAGACGTGC  AGTGAGCCGAAGACAAGCAAGGAGGTGTGCACAGAGTGCGAAGACCCCAAGGCCCTCACGCCCACGGGC  CAGTGCATCTACGGTTGTGAGCACCTGGAAGGCTACTACGAGGGCACCAGCGAGGGGGGCAAGAAGGCC  TGCAAGAAGTGCGAGGTCGAGAACTGCCTCCTGTGCAACGGGCAAGGACAGTGCGAGACCTGCAAGGAC  GGGTACTACAAGAGCGGAGCCGCCTGTGCCAAGTGCAATACCTCGTGCAAGACGTGCGCGAACGGGAAC  TCCAACGGGTGCACGAGCTGCGAGCCTAAGCAGGTCCTCAGCTACGAAGGAGAGGGCACGGGGACGTGC  AAGCCAGGCTGCAAGCCAGTGAGCGGCGGCAAGGATGGAACGTGCAAGAGCTGCGACCTGAACATAGAC  GGGACAAGCTACTGTTCTGCCTGTAACGTGGGCACGGAGTATCCAGAGAACGGCGTGTGCGTCAAGAAG  TCGGCCCGCACAGCCTCCTGCCAGGCAGAACCGAGCAATGGTGTGTGCGGGACATGTGCAAGGGGCTTC  TTCCGCATGAACGGGGGCTGCTACGAAACGACCAAACTCCCTGGAAAGAGCGTCTGTGAGGAGGTAGCA  TCGGCCGGCGATACCTGTCAGACTCCGGCCGACGGATACAAGCTGAATAATGGCGCGCTCATCACTTGC  TCGGCCGGATGTAAGACGTGCACCAGCCAGGACCAGTGCGACACGTGTAAGGCTGGATATGCTAAGACT  GGCGGTAACACTAAGAAGTGCGTTCCCTGCGCCACTGGGTGCTCCGAGTGCAATGCGGACGACGCCACC  AAGTGCACGGTGTGCGCTGCAGGGTACTACCTGTCCAAAGAAAAGTGCATAGCATGCGACAAGAGCGAC  GGCGGATCCATCACCGGCGTCGCCAACTGCGCCAACTGCGCTCCCCCAACCAACAATAAAGGGCCTGTC  CTCTGCTACCTCATACAGAACACCAACAGGAGCGGGCTTTCCACG 

VSP Carriers from VSP-Like Domains

In some embodiments, a VSP carrier comprises a VSP sequence chosen from among VSP-like domains, fragments, variants or derivatives thereof from microorganisms other that Giardia. These VSP-like proteins share sequence homology and biochemical properties with Giardia VSPs. In some embodiments, VSP-like sequences selected to be used as VSP carriers comprise multiple CXXC motifs. In some embodiments, such multiple CXXC motifs are separated by 5 to 8 amino acids.

Alignment of the sequence of the extracellular domain of the Giardia VSP1267, used herein as an exemplary VSP carrier, with other VSP-like molecules sequences has led to observe the presence of multiple CXXC motifs, notably separated by 5 to 8 amino acids, in proteins belonging to Paramecium, Tetrahymena and Entamoeba species. Thus, representative fragments of primary sequences of surface kinases of Entamoeba sp., and surface proteins of Paramecium sp. and Tetrahymena sp. predict a conserved domain containing CXXC motifs in a VSP-like architecture (compared with Giardia VSP1267, 9B10 (SEQ ID NO:3), and H7 as responsible for resistance to pH, temperature and proteolytic digestion).

In one embodiment, the Tetrahymena microorganism is Tetrahymena thermophila. In another embodiment, the Entamoeba microorganism is Entamoeba histolytica. In another embodiment, the Paramecium microorganism is Paramecium tetraurelia.

In one embodiment, the VSP carrier comprises the extracellular domain of a VSP-like protein, or a fragment, variant or derivative thereof (since said extracellular domain is the amino-terminal cysteine rich region comprising multiple CXXC motifs of the Giardia VSP protein). In another embodiment, the VSP carrier comprises only the extracellular domain of a VSP-like protein, or fragment, variant, or derivative thereof.

Thus, in some embodiments, the VSP carrier is a fragment, analog or derivative of a VSP-like protein comprising 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 CXXC motifs. In some embodiments, the VSP carrier comprises at least about 40, at least about 50, at least about 60, at least about 70, at least 80, about 90 or at least about 100 CXXC motifs from a VSP-like protein.

VSPs as Therapeutic Agent Carriers

The VSP carriers can be used to deliver therapeutic agents to a subject in need thereof. Thus, in some embodiments, the present disclosure provides a therapeutic composition comprising a VSP carrier and a therapeutic agent. This therapeutic composition can be formulated, for example, for oral administration. In some embodiments, the therapeutic composition is formulated for mucosal administration. As disclosed above, the VSP carrier can comprise without limitation a VSP, a VSP-like protein, a VSP or VSP-like protein fragment, a VSP or VSP-like protein derivative, or a combination of two or more of said VSP carriers. In specific embodiments, the VSP carrier comprises a VSP from Giardia (e.g., VSP1267) or a fragment thereof, e.g., a VSP extracellular domain or a fragment of such extracellular domain.

In some embodiments, the VSP carrier comprises a VSP protein sequence and further comprises a heterologous moiety, for example, a purification tag such as a Hi6 tag. In other embodiments, the heterologous moiety can be a protein, peptide, polymer, etc. that can improve a pharmokinetic or pharmacodynamic property such as half-life. In a specific embodiment, the VSP carrier is SEQ ID NO:1, i.e., the extracellular domain of Giardia VSP1267, including the N-terminal signal peptide, and a C-terminal His6 tag.

Therapeutic agents that can be delivered by a VSP carrier include biological agents. The term “biological agent” includes both proteins and non-protein therapeutic agents. Exemplary non-protein therapeutic agents include polysaccharides, lipids, drugs (e.g., small molecule drugs), nucleic acids (e.g., oligonucleotides), lipopolysaccharides, ribozymes, genetic materials, prions, viruses, etc.

In some embodiments of the present invention, the therapeutic agent is a pharmacologically active polypeptide. In some embodiments, the polypeptide is a bioactive peptide, e.g., a cytokine, an interleukin (e.g., IL-2 or IL-10), a hormone (e.g., parathormone), a growth factor, or a receptor. In specific embodiments, the bioactive peptides can be, without limitation, insulin, human growth hormone, glucagon, parathormone, IL-2, IL-10, as well as fragments, analogs, derivatives or variants thereof, or combinations of two or more of these bioactive peptides. The examples provided above are non-limiting, and it is contemplated that a VSP carrier can be used to delivered other bioactive peptides and proteins. For example, VSP carriers can be used for oral or mucosal delivery of proteins comprising antigen-binding domains such antibodies and fragments thereof (e.g., scFv's or scFv-comprising molecules).

In some specific embodiments, the bioactive peptide is insulin, e.g., a natural insulin, a recombinant insulin, or an insulin analog. In some embodiments, the insulin analog is a fast-acting insulin (e.g., insulin Aspart), a long-lasting insulin (e.g., insulin Glargine) or a combination thereof. Numerous insulin analogs are known in the art.

Therapeutics agents can also include classical low molecular weight therapeutic agents commonly referred to as drugs, including but not limited to antineoplastic, immunosupressants, antioproliferatives, antithrombins, antiplatelet, antilipid, anti-inflammatory, angiogenic, antiangiogenic, vitamins, ACE inhibitors, vasoactive substances, antimitotics, metalloproteinase inhibitors, NO donors, estradiols, or antisclerosing agents, alone or in combination. In some embodiments, the drug is a drug poorly soluble under aqueous conditions, for example an antibiotic.

The therapeutic agent can also be a compound that needs to be activated in order to be therapeutically active, e.g., a prodrug or a zymogen. In such embodiments, the therapeutic agent is metabolized into the desired drug or biological agent after it has been administered to a subject in combination with a VSP carrier.

In some embodiments, the VSP carrier is bound directly to the therapeutic agent. In other aspects, the VSP carrier is bound to a vector particle containing the therapeutic agent. Accordingly, the vector particle can be a viral particle, a virus-like particle (VLP), a nanoparticle, or a liposome. In one particular aspect, the vector particle is a viral particle displaying at its surface the therapeutic agent. In another aspect, the vector particle is a viral which does not display the therapeutic agent on its surface. In one particular aspect, the vector particle is a VLP displaying at its surface the therapeutic agent. In another aspect, the vector particle is a VLP encapsulating the therapeutic agent. In one particular aspect, the vector particle is a nanoparticle displaying at its surface the therapeutic agent. In another aspect, the vector particle is a nanoparticle encapsulating the therapeutic agent. In one particular aspect, the vector particle is a liposome displaying at its surface the therapeutic agent. In another aspect, the vector particle is a liposome encapsulating the therapeutic agent. In another particular aspect, the therapeutic agent is contained within the surface of the vector particle, e.g., within a lipid bilayer in a liposome.

In a particular embodiment, the vector particle is a virus-like particle (VLP). Where virus-like particles are being used, they can be prepared according to techniques known in the art and for example as described in Intl. Pat. Appl. Publ. No. WO 2002/34893, which is incorporated therein by reference in its entirety. In some embodiments, the VLP displays at its surface a VSP carrier and a therapeutic agent. Thus, in some embodiments, a VSP carrier can be bound to a therapeutic agent exposed at the surface of the VLP.

The VSP carrier according to the invention can form a protecting surface (as it occurs naturally in the parasite trophozoites) that allows for the correct delivery of the therapeutic agent into the mucosa (e.g., intestinal mucosa), without suffering degradation in the digestive tract.

In certain embodiments, the VSL carriers provided herein are not covalently attached to the therapeutic agents via peptidic bonds. Thus, prior to administration, a VSP carrier is “combined” with at least one therapeutic agent. As disclosed above, the term “combine” refers to the process of admixing two or more components (e.g., a VSP carrier and a therapeutic agent) such that contact between the components occur and such contact allows the binding of the two or more components.

In some embodiments, a VSP carrier can be combined with one therapeutic agent. In other embodiments, a VSP carrier can be combined with more than one therapeutic agent. In some embodiments when a VSP carrier is combined with more than one therapeutic agent, the VSP carrier can bind to only one of the therapeutic agents. In other embodiments, the VSP carrier can bind to more than one of the therapeutic agents.

In some embodiments, two or more VSP carriers can be combined with one therapeutic agent. In other embodiments, two or more than two VSP carriers can be combined with more than one therapeutic agent. In some embodiments, when two or more than two VSP carriers are combined with more than one therapeutic agent, each VSP carrier can bind to only one of the therapeutic agents. In other embodiments, each VSP carrier can bind to more than one therapeutic agent.

In some embodiments, the molecule to molecule ratio of VSP carrier to therapeutic agent (VSP carrier:therapeutic agent) ranges from about 10:1 to about 1:10. In other embodiments, the molecule to molecule ratio of VSP carrier to therapeutic agent (VSP carrier:therapeutic agent) ranges from about 3:1 to about 1:3. In some embodiments, the molecule to molecule ratio of VSP carrier to therapeutic agent (VSP carrier:therapeutic agent) is 3:1. In other embodiments, the molecule to molecule ratio of VSP carrier to therapeutic agent (VSP carrier:therapeutic agent) is 1:1.

In some embodiments, the molecule to molecule ratio of VSP carrier to therapeutic agent (VSP carrier:therapeutic agent) is about 1:1, about 2:1, about 3:1, about 4:1, about 5:1, about 6:1, about 7:1, about 8:1, about 9:1, or about 10:1. In some embodiments, the molecule to molecule ratio of VSP carrier to therapeutic agent (VSP:therapeutic agent) is higher that 10:1. In some embodiments, the molecule to molecule ratio of VSP carrier to therapeutic agent (VSP carrier:therapeutic agent) is about 1:2, about 1:3, about 1:4, about 1:5, about 1:6, about 1:7, about 1:8, about 1:9, or about 1:10. In some embodiments the molecule to molecule ratio of VSP carrier to therapeutic agent (VSP:therapeutic agent) is lower than 1:10.

In some aspects, the VSP carrier and the therapeutic agent are co-administered, i.e., they are administered simultaneously to the subject, so they combine at the time of administration. In some aspects, the VSP carrier and the therapeutic agent are combined prior to administration. In some aspects, the combination of VSP carrier and therapeutic agent can take place at least about 1 minute, at least about 2 minutes, at least about 3 minutes, at least 4 minutes, at least about 5 minutes, at least about 10 minutes, at least about 15 minutes, at least about 20 minutes, at least about 25 minutes, at least about 30 minutes, at least about 45 minutes, at least about 1 hours, at least about 2 hours, at least 3 hours, at least about 4, or at least 6 hours prior to administration. In some embodiments, the VSP carrier and the therapeutic agent are combined at least 1 day, at least 2 days, at least 3 days, at least 4 days, at least 5 days, at least 6 days, or at least 7 days prior to administration. In some embodiments, a VSP carrier and a therapeutic agent are combined in a stable form that can be used days, weeks or months after combining the VSP carrier and the therapeutic agent.

VSP as an Insulin Carrier

In certain aspects, a VSP carrier can be combined with an insulin for oral or mucosal administration to a subject.

As used herein, the term “insulin” comprises insulin analogs, natural extracted mammalian insulin (e.g., human insulin), recombinantly produced mammalian insulin (e.g., human insulin), insulin extracted from bovine and/or porcine sources, recombinantly produced porcine and bovine insulin, insulin produced in transgenic animals, and mixtures of any of these insulin products. The term is intended to encompass the polypeptide normally used in the treatment of diabetics in a substantially purified form, but encompasses the use of the term in its commercially available pharmaceutical form, which includes additional excipients. The insulin used to combine with a VSP carrier can be recombinantly produced and can be dehydrated (completely dried) or in solution.

The term “insulin analog” refers to any form of “insulin” as defined above, where one or more of the amino acids within the polypeptide chain has been replaced with an alternative amino acid and/or where or more of the amino acids has been deleted or wherein one or more additional amino acids has been added to the polypeptide chain or amino acid sequences, which act as insulin in decreasing blood glucose levels. In general, the term “insulin analogs” includes, e.g., “insulin Lispro” analogs as disclosed, e.g., in U.S. Pat. No. 5,547,929, which is herein incorporated by reference in its entirety; insulin analogs including LysPro insulin and Humalog insulin and other “super insulin” analogs, wherein the ability of the insulin analog to affect serum glucose levels is substantially enhanced as compared with conventional insulin as well as hepatoselective insulin analogs which are more active in liver than in adipose tissue. The term “insulin analogs” also includes chemically and enzymatically modified insulins (e.g., mammalian insulins chemically converted into human insulin), NPH insulin (e.g., the intermediate-acting isophane insulin), insulin Aspart, insulin Glulisine, insulin Glargine, insulin Detemir, insulin Degludec, etc.

In some embodiments, insulin analogs are monomeric insulin analogs, which are insulin-like compounds used for the same general purpose as insulin, such as insulin lispro, e.g., any compounds that are administered to reduce blood glucose levels.

“Insulin analogs” are well known compounds. Insulin analogs are known to be divided into two categories: animal insulin analogs and modified insulin analogs (pages 716-20, chapter 41, Nolte M. S, and Karam, J. H., “Pancreatic Hormones & Antidiabetic Drugs” In Basic & Clinical Pharmacology, Katzung, B. G., Ed., Lange Medical Books, New York, 2001). Historically, animal insulin analogs include porcine insulin (having one amino acid different from human insulin) and bovine insulin (having three amino acids different from human insulin), which have been widely used for treatment of diabetes. Since the development of genetic engineering technology, modifications are made to create modified insulin analogs, including fast-acting insulin analogs or longer acting insulin analogs. Several insulin analog molecules have been on the market prior to the filing date of the subject application. For example, Eli Lilly markets a fast-acting insulin analog called “Lispro” under the trade name HUMALOG® and Novo Nordisk sells another fast-acting insulin analog called “Aspart” under the trade name NOVOLOG®. In addition, Aventis markets a long-acting insulin analog called “Glargine” under the trade name LANTUS® and Novo Nordisk markets another long-acting insulin analog called “Detemir” under the trade name LEVEMIR®. Table 41-4 of the Nolte and Karam (2001) reference cited above provides a non-limiting list of the wide range of types of molecules generically referred to as insulin.

The term insulin also encompasses insulin as defined above covalently coupled to one or more heterologous moieties that can improve pharmacokinetic and/or pharmacodynamic properties over native insulins, e.g., PEGylated insulins (see, e.g., U.S. Pat. No. 6,890,518). See also, U.S. Pat. Nos. 7,049,286; 7,470,663; 6,890,518; and U.S. Appl. Pub. Nos. US2008/0139784; US2011/0281791; US2009/0036353; US20110020871; US2009/0239785.

In some embodiments, a VSP carrier can be combined with a non-insulin peptide with insulinotropic activity. In some embodiments, the non-insulin peptide with insulinotropic activity an incretin. In some embodiments, the incretin is a glucagon-like peptide-1 (GLP1) receptor agonist. In some embodiments, a VSP carrier can be combined with GLP1 or an analog, variant, fragment, or derivative thereof. In some embodiments, the GLP1 analog is liraglutide (marketed as VICTOZA™). In other embodiments, the GLP1 analog is albiglutide. In yet other embodiments, the GLP1 analog is taspoglutide.

In other embodiments, a VSP carrier can be combined with exendin-4, or an analog, variant, fragment, or derivative thereof. In some embodiments, a VSP carrier can be combined with exenatide (marketed as BYETTA®, and BYDUREON®). In other embodiments, a VSP carrier can be combined with lisexenatide.

In yet other embodiments, a VSP carrier can be combined with a DPP-4 inhibitor (gliptin). In some embodiments, the DPP-4 inhibitor is alogliptin. In other embodiments, the DPP-4 is, for example, sitagliptin (marketed as JANUVIA®), vildagliptin (marketed as GALVUS®), saxagliptin (marketed as ONGLYZA®), linagliptin (marketed as TRADJENTA®), dutogliptin, gemigliptin, berberine, or lupeol.

VSP as a Glucagon Carrier

In certain aspects, a VSP carrier can be combined with glucagon for oral or mucosal administration to a subject.

As used herein, the term “glucagon” comprises glucagon analogs, natural extracted mammalian glucagon (e.g., human glucagon), recombinantly produced mammalian glucagon (e.g., human glucagon), glucagon extracted from bovine and/or porcine sources, recombinantly produced glucagon, glucagon produced in transgenic animals, and mixtures of any of these glucagon products. The term is intended to encompass the polypeptide normally used in the treatment of hypoglycemia in a substantially purified form, but encompasses the use of the term in its commercially available pharmaceutical form, which includes additional excipients. The glucagon used to combine with a VSP carrier can be recombinantly produced. In some embodiments, glucagon can be dehydrated (completely dried) or in solution.

VSP as a Growth Hormone Carrier

In certain aspects, a VSP carrier can be combined with a growth hormone, e.g., human growth hormone, for oral or mucosal administration to a subject.

The terms “growth hormone (GH)” refers generally to growth hormones secreted by the pituitary gland in mammals. Although not an exhaustive list, examples of mammals include human, apes, monkey, rat, pig, dog, rabbit, cat, cow, horse, mouse, rat and goat. In some embodiments of the present invention, the mammal is a human.

The terms “human growth hormone” and “hGH” are used interchangeably and refer to a protein having an amino acid sequence, structure and function characteristic of native human growth hormone. As used herein, hGH also includes any isoform of native human growth hormone, including but not limited to, isoforms with molecular masses of 5, 17, 20, 22, 24, 36 and 45 kDa (see, e.g., Haro et al., J. Chromatography B, 720, 39-47 (1998)). Thus, the term hGH includes the 191 amino acid sequence of native hGH, somatotropin, and the 192 amino acid sequence containing an N-terminal methionine (Met-hGH) and somatrem (see, e.g., U.S. Pat. Nos. 4,342,832 and 5,633,352). hGH can be obtained by isolation and purification from a biological source or by recombinant DNA methods. Met-hGH is typically prepared by recombinant DNA methodology.

The term “human growth hormone” also encompasses human growth hormone derivatives. The term “human growth hormone derivative” refers to a protein that differs by at least about 1% but not by more than about 20% from the amino acid sequence of the 191 amino acid sequence of hGH or the 192 amino acid-sequence of Met-hGH. For example, the derivative can differ by about 1% to about 20%, about 2% to about 15%, or about 5% to about 10% from the 191 amino acid sequence of hGH or the 192 amino acid-sequence of Met-hGH; the protein can differ by about 1%, about 2%, about 3%, about 4%, about 51%, about 6%, about 7%, about 8%, about 9%, about 10%, about 11%, about 12%, about 13%, about 14%, or about 15% from the 191 amino acid sequence of hGH or the 192 amino acid-sequence of Met-hGH. The differences between the derivative and the 191 amino acid hGH or the 192 amino acid Met-hGH amino acid sequence can be one or more substitutions (e.g., conservative or non-conservative substitutions), deletions, additions (e.g., insertions or amino- or carboxy-terminal additions)), modifications, or combinations thereof.

In some embodiments, an hGH derivative maintains a biological activity and/or a chemical and/or physical property of the 191 amino acid hGH or the 192 amino acid Met-hGH amino acid sequence. Likewise, in some embodiments, a formulation containing a derivative (e.g., a formulation of poly-Arg complexed crystalline hGH derivative) possesses a chemical and/or physical property of a similarly-prepared formulation containing the 191 amino acid hGH or the 192 amino acid Met-hGH amino acid sequence (e.g., a formulation of poly-Arg complexed crystalline hGH).

In various embodiments of the present disclosure, human growth hormone derivatives comprise organic cations of hGH or Met-hGH, substitution, deletion and insertion variants of biologically synthesized hGH or Met-hGH proteins, post-translationally modified hGH and Met-hGH proteins, including—without limitation—deamidation, phosphorylation, glycoslylation, acetylation, aggregation and enzymatic cleavage reactions (see, e.g., Haro et al., J. Chromatography B, 720, 39-47 (1998)), chemically modified hGH or Met-hGH proteins derived from biological sources, polypeptide analogs and chemically synthesized peptides containing amino acid sequences analogous to those of hGH or Met-hGH. Methods used to prepare hGH or Met-hGH include isolation from a biological source, recombinant DNA methodology, synthetic chemical routes or combinations thereof. Genes that encode for different DNA sequences of hGH include hGH-N and hGH-V (see, e.g., Haro et al., J. Chromatography B, 720, 39-47 (1998); Bennani-Baiti et al., Genomics, 29, 647-652 (1995)). hGH is commercially available in lyophilized form and is typically produced by recombinant DNA methods.

Production of VSP Carriers

Recombinant expression of the VSP carriers can be achieved through the construction of an expression vector containing a polynucleotide that encodes a VSP carrier. Once a polynucleotide encoding a VSP carrier has been obtained, the vector for the production of the VSP carrier can be produced by recombinant DNA technology using techniques well known in the art.

Methods for preparing a protein by expressing a polynucleotide containing a VSP carrier-encoding nucleotide sequence are known in the art. Methods that are well known to those skilled in the art can be used to construct expression vectors containing VSP carrier coding sequences and appropriate transcriptional translational control signals. These methods include, for example, in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. The disclosure, thus, provides replicable vectors comprising a nucleotide sequence encoding a VSP carrier operably linked to a promoter.

An expression vector can be transferred to a host cell by conventional techniques and the transfected cells can then be cultured by conventional techniques to produce a VSP carrier. Thus, the invention includes host cells containing a polynucleotide encoding a VSP carrier, operably associated with a promoter. Suitable host cells include, but are not limited to, microorganisms such as bacteria (e.g., E. coli and B. subtilis), fungal cells, mammalian cells, or insect cells.

A variety of host-expression vector systems can be utilized to express the VSP carrier of the present disclosure. Such host-expression systems represent vehicles by which the coding sequences of interest can be produced and subsequently purified, but also represent cells which can, when transformed or transfected with the appropriate nucleotide coding sequences, express a VSP carrier in situ. These include but are not limited to microorganisms such as bacteria (e.g., E. coli and B. subtilis) transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing VSP carrier coding sequences, fungal cell system (e.g., Saccharomyces or Pichia), mammalian cell systems (e.g., COS, CHO, BHK, 293, NSO, and 3T3 cells), or insect cell systems (Sf9, Hi5). Once a VSP carrier has been produced by recombinant expression, it can be purified by any method known in the art for purification of a protein.

In some embodiments, a DNA encoding a VSP carrier is codon optimized for expression in an insect protein expression system, e.g., a baculovirus expression system. In some embodiments, a VSP carrier is expressed in an insect protein expression system, e.g., a baculovirus expression system in Sf9 or Hi5 insect cells.

Pharmaceutical Compositions

In another aspect, the present disclosure provides a therapeutic composition including, but not limited to, a pharmaceutical composition, containing one or more than one VSP carrier combined with one or more than one therapeutic agents, formulated together with a pharmaceutically acceptable excipient. Such compositions can include one or a combination of two or more different VSP carriers. For example, a pharmaceutical composition can comprise a combination of VSP carriers that bind to the same therapeutic agent or to more than one therapeutic agent. These therapeutic agents can have complementary activities. In a specific aspect, a pharmaceutical composition comprises a single VSP carrier. In a specific embodiment, a pharmaceutical composition comprises more than one VSP carriers.

Pharmaceutical compositions comprising one or more VSP carriers also can be administered in combination therapy. For example, the combination therapy can include a pharmaceutical composition which comprises at least one VSP carrier combined with at least one therapeutic agent, combined with at least one other therapy wherein the therapy can be immunotherapy, chemotherapy, radiation treatment, or drug therapy. Pharmaceutical compositions of the invention can include one or more pharmaceutically acceptable salts.

Examples of suitable aqueous and non-aqueous carriers that can be employed in contemplated pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.

In another aspect, pharmaceutical compositions comprising a VSP carrier can also contain agents such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms can be ensured both by sterilization procedures and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It can also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption can be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.

Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the invention is contemplated. Supplementary active compounds can also be incorporated into the pharmaceutical compositions of the invention.

Actual dosage levels of the active ingredients in pharmaceutical compositions comprising a VSP carrier can be varied so as to obtain an amount of the active ingredient that is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.

A therapeutically effective dosage of pharmaceutical composition comprising a VSP carrier can be indicated by a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction. A therapeutically effective dose can also prevent or delay onset of disease. Accordingly, any clinical or biochemical monitoring assay can be used to determine whether a particular treatment is a therapeutically effective dose. One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.

Therapeutic compositions comprising a VSP carrier are particularly well suited for oral administration. Alternatively, therapeutic compositions comprising a VSP can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, buccally, vaginally, rectally, sublingually or topically. Of course, therapeutic compositions comprising a VSP carrier can be administered via one or more alternative routes of administration using one or more of a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results.

In certain embodiments, therapeutic compositions comprising VSP carriers are formulated for an oral or a mucosal administration. The doses used for the oral or a mucosal administration can be adapted as a function of various parameters, and in particular as a function of the mode of the relevant pathology, or alternatively of the desired duration of treatment.

Upon formulation, pharmaceutical compositions comprising VSP carriers can be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective. The formulations are easily administered in a variety of dosage forms, such as the type of, e.g. tablets or other solids for oral or a mucosal administration; time release capsules; and any other form currently used. Accordingly, the pharmaceutical composition may be in the form of a spray, an aerosol, a mixture, a suspension, a dispersion, an emulsion, a gel, a paste, a syrup, a cream, an ointment, implants (ear, eye, skin, nose, rectal, and vaginal), intramammary preparations, vagitories, suppositories, or uteritories). In certain embodiments, the use of liposomes is contemplated. The formation and use of liposomes are known to those of skill in the art.

More particularly, the pharmaceutical composition is formulated so that the therapeutic agent in the therapeutic composition of the invention is resistant to enzymatic and chemical degradation of the upper gastrointestinal tract, when necessary. Moreover, in certain embodiments, a VSP carrier should be able to attach to cells, more particularly epithelial cells of the gut.

Methods

The VSP carriers of the present disclosure have in vitro and in vivo therapeutic and diagnostic utility. For example, the VSP carriers can be used to administer therapeutic agents or diagnostic reagents to cells in culture, e.g., in vitro or ex vivo, or in a subject, e.g., in vivo, to treat, prevent or diagnose a variety of disorders. A disease, a disorder or physiologic conditions considered in the invention can be, but it is not limited to, hormone deficiencies, cancers, immunological diseases, autoimmune diseases, allograft rejections, viral diseases, such as influenza or AIDS, parasitic diseases, bacterial infections, or allergies.

The present disclosure provides a method of delivering a therapeutic agent to a target location in a subject comprising the administration of a therapeutic composition comprising a VSP carrier and a therapeutic agent. In some specific embodiments of the disclosed method of delivering, the VSP carrier is the VSP1267 carrier and the therapeutic agent is a bioactive peptide such as insulin, glucagon, or hGH.

Also provided is a method of treating a disease or condition in a subject comprising administering to said subject an effective amount of a therapeutic composition comprising a VSP carrier and a therapeutic agent. In some embodiments, the disease or condition is a hormone deficiency. In specific embodiments, the hormone deficiency is an insulin deficiency. In some embodiments, the insulin deficiency is type 1 diabetes. In some specific embodiments, the method of treating the hormone deficiency comprises administering the VSP1267 carrier and a bioactive peptide such as insulin, glucagon, or hGH.

The present disclosure also provides a method of treating a disease or condition in a subject comprising combining a VSP carrier and a therapeutic agent, wherein the VSP carrier can bind to the therapeutic agent, and administering an effective amount of the combination of VSP carrier and therapeutic agent to the subject. In some specific embodiments, the VSP carrier is the VSP1267 carrier and it is combined with a therapeutic agent, which is a bioactive peptide such as insulin, glucagon, or hGH.

The present disclosure also provides a method of making an orally or mucosally deliverable composition, comprising combining a VSP carrier and a therapeutic agent, wherein the VSP carrier can bind to the therapeutic agent. In some specific embodiments, the orally or mucosally deliverable composition comprises the VSP1267 carrier combined with a therapeutic agent, which is a bioactive peptide such as insulin, glucagon, or hGH.

Also disclosed herein is a method of making an injectable composition suitable for oral or mucosal administration comprising combining a VSP carrier and a therapeutic agent, wherein the VSP carrier can bind to the therapeutic agent. In some specific embodiments, the orally or mucosally deliverable injectable composition comprises the VSP1267 carrier combined with a therapeutic agent, which is a bioactive peptide such as insulin, glucagon, or hGH.

Also provided in the present disclosure is a method of increasing resistance of a therapeutic agent to enzymatic degradation comprising combining a VSP carrier and a therapeutic agent, wherein the VSP carrier can bind to the therapeutic agent, and wherein combining the VSP carrier and the therapeutic agent results in improved resistance of the therapeutic agent to enzymatic degradation. In some specific embodiments, the VSP carrier is the VSP1267 and the therapeutic agent is a bioactive peptide such as insulin, glucagon, or hGH.

The present disclosure also provides a method of increasing the resistance of a therapeutic agent to pH denaturation comprising combining the therapeutic agent with a VSP carrier, wherein the VSP carrier can bind to the therapeutic agent, and wherein combining the VSP carrier and the therapeutic agent results in improved resistance of the therapeutic agent to pH denaturation. In some specific embodiments, the VSP carrier is the VSP1267 and the therapeutic agent is a bioactive peptide such as insulin, glucagon, or hGH.

The present disclosure also provides a method of increasing simultaneously the resistance of a therapeutic agent to enzymatic degradation and its resistance to pH denaturation comprising combining the therapeutic agent with a VSP carrier, wherein the VSP carrier can bind to the therapeutic agent, and wherein combining the VSP carrier and the therapeutic agent results in an increased resistance of a therapeutic agent to enzymatic degradation and increased resistance to pH denaturation. In some embodiments, the combination of the VSP carrier and the therapeutic agent increases the therapeutic agent's resistance to pH-mediated degradation when exposed to a pH ranging between about 1 and about 2, or between about 2 and about 3, or between about 3 and about 4, or between 4 and about 5, or between about 5 and about 6, or between about 6 and 7, or between about 7 and about 8, or between about 8 and about 9, or between about 9 and about 10, or between about 10 and about 11, over between about 11 and about 12, or between about 12 and about 13, or between about 13 and about 14. In some specific embodiments, the VSP carrier is the VSP1267 and the therapeutic agent is a bioactive peptide such as insulin, glucagon, or hGH.

Also provided is a method of improving the attachability of a therapeutic agent to mucosal epithelial cells comprising combining a therapeutic agent with a VSP carrier, wherein the VSP carrier can bind to the therapeutic agent, and wherein combining the VSP carrier and the therapeutic agent results in improved attachability of the therapeutic to mucosal epithelial cells. In some specific embodiments, the VSP carrier is the VSP1267 and the therapeutic agent is a bioactive peptide such as insulin, glucagon, or hGH. In some embodiments, the mucosal epithelial cells are intestinal epithelial cells. In other embodiments, the mucosal epithelial cells as gastric epithelial cells. In other embodiments, the mucosal epithelial cells are oral epithelial cells. Mucosal delivery, i.e., delivery of a therapeutic agent to mucous tissue by a VSP carrier refers, e.g., to delivery to bronchial and other respiratory tract mucosal tissues, gingival, lingual, nasal, oral, gastrointestinal, and genitourinary tract mucosal tissues.

The invention also provides methods of using VSP carriers in diagnostics. In some embodiments, a VSP carrier can be combined with one or more than one diagnostic reagents. The invention also provides methods of imaging specific targets using VSP carriers. In one embodiment, a VSP carrier is combined imaging agents such as green-fluorescent proteins, other fluorescent tags (Cy3, Cy5, Rhodamine and others), biotin, or radionuclides to be used in methods to image the presence, location, or progression of a specific target. In some aspects, the method of imaging a target comprising a VSP carrier is performed by MRI, PET scanning, X-ray, fluorescence detection, or by other detection methods known in the art.

Therapies comprising the use of VSP carriers can be combined with conventional therapies suitable for the prevention, treatment, reduction or amelioration of disease or symptoms thereof. Exemplary conventional therapies can be found in the Physician's Desk Reference (56th ed., 2002 and 57th ed., 2003). In some embodiments, therapies using VSP carriers can be combined with chemotherapy, radiation therapy, surgery, immunotherapy with a biologic (e.g., an antibody or antigen-binding fragment thereof, or a peptide, e.g., a bioactive peptide), small molecules, or another therapy known in the art. In some embodiments, the combinatorial therapy is administered together with the therapy comprising the use of VSP carriers. In other embodiments, the combinatorial therapy is administered separately from the therapy comprising the use of VSP carriers.

The present disclosure also provides methods of monitoring disease progression, relapse, treatment, or amelioration using the VSP carriers. In one embodiment, methods of monitoring disease progression, relapse, treatment, or amelioration is accomplished by the methods of imaging, diagnosing, or contacting a compound/target with a VSP carrier as presented herein.

The present disclosure also provides a method to increase the solubility of a poorly soluble drug (e.g., a small molecule drug) by combining it with a VSP carrier, wherein the binding of the poorly soluble drug to the VSP carrier increases the solubility of the drug. In some embodiments, the poorly soluble drug is a small molecule drug used to treat a hormonal imbalance (e.g., an antidiabetic small molecule drug). In other embodiments, the poorly soluble drug is an antibiotic. In some embodiments, the antibiotic is an aminoglycoside antibiotic, e.g., amikacin. In other embodiments, the antibiotic is a glycopeptide antibiotic, e.g., vancomycin.

Kits

Also provided is a pharmaceutical pack or kit comprising one or more containers filled with one or more of the pharmaceutical compositions disclosed herein. Optionally associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration. The present disclosure provides kits that can be used in the above methods of treatment and administration. In one aspect, a kit comprises a VSP carrier, preferably in a purified form, in one or more containers. In some embodiments, the kit comprises a VSP carrier combined with a therapeutic in one container. In other embodiments, the kit comprises a VSP carrier and a therapeutic agent in different containers.

Equivalents

Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.

All publications, patents, and patent applications referred to herein are expressly incorporated by reference in their entireties.

EXAMPLES Example 1 VSP Resistance to Variable pH and to Digestion by Intestinal Proteases

VSPs are integral membrane proteins of protozoan parasites, e.g., Giardia lamblia, with a variable extracellular region rich in CXXC motifs, a unique transmembrane hydrophobic regions and a short, 5 amino acid-long cytoplasmic tail (FIG. 1A) (Lujan, Essays Biochem. 51:177-91 (2011); Prucca et al., Annu. Rev. Microbiol. 65:611-30 (2011). Each trophozoite (the active, motile stage of the Giardia parasite that colonizes the upper small intestine of several vertebrates and the cause of the symptoms of the disease) expresses a single VSP on its surface, as shown in FIGS. 1B and 1C. FIG. 1B shows phase contrast (left panel) and immunofluorescence (right panel) assays showing that, from a group of Giardia trophozoites only one expresses on its surface the VSP9B10 VSP, as demonstrated by surface labeling with an anti-VSP9B10 specific monoclonal antibody, while the other cells express different surface proteins (Prucca & Lujan, Cell. Microbiol. 11:1706-15 (2011). FIG. 1C shows an inmuno electron microscopy of a Giardia trophozoite using an anti-VSP specific monoclonal antibody. It can be observed that the entire surface of the parasite is labeled, including the ventral disk and the flagella, generating a thick surface coat composed by VSPs that protect the parasite within the highly hydrolytic environment of the upper small intestine (Pimenta et al., Infect. Immun. 59: 3989-96 (1991).

Purified VSPs are not toxic for cells when added to cultures and they are not toxic for the animals when administered by the oral route. Animals do not lose weight and have no diarrhea, which are commonly associated to Giardia infections (see Rivero et al., Nat. Med. 16(5):551-7 (2010)). Despite their lack of toxicity, to be useful as therapeutic agent carriers, VSPs must be able to survive the harsh conditions of the GIT.

To determine whether VSPs are resistant to variable pH and to proteolytic digestion, two different Giardia isolates (clonal trophozoite populations) were treated with trypsin and with variable pH and the effect of those conditions on the VSP expressed by each isolate were monitored using immunofluorescence assays.

For the trypsin resistance assay, Giardia parasites were resuspended in PBS at pH 7.4 and treated for 90 minutes with variable concentrations of trypsin similar of those found in the upper small intestine. Afterwards, the parasites were washed, and incubated with two monoclonal antibodies, each one recognizing the particular VSP expressed by each of the two isolates tested: the GS/M isolate and the WB isolate. The monoclonal antibody G10/4 recognized a conformational epitope in VSPH7 of the GS/M isolate. The monoclonal antibody 9B10 detected a non-conformational epitope in VSP9B10 of the WB isolate. The antibodies agglutinated the trophozoites and labeled the surface of the parasites (Rivero et al., Nat. Med. 16:551-7 (2010).

It was observed that after incubation with 100 μg/mL or 200 μg/mL of trypsin, the presence of both VSP proteins was still detectable by the monoclonal antibodies, indicating that both VSPs survived trypsinization (FIG. 2A).

For the pH resistance assay, Giardia parasites were resuspended in RPMI cell culture medium at variable pHs, from pH 1 to pH 10, in 1 pH unit increments (only pH 1, 3, 5 and 10 are shown in FIG. 2B). Giardia parasites were kept at the different pHs for 90 minutes, washed, and then incubated with the corresponding monoclonal antibody. In all cases the VSP epitopes in VSPH7 and VSP9B10 remained intact as determined by immunofluorescence microscopy, indicating that both VSPs survived exposure to variable pH without undergoing chemical degradation (FIG. 2B) (Rivero et al., Nat. Med. 16:551-7 (2010).

Resistance to proteolytic digestion was also demonstrated using Western Blot analysis of VSPs after treating trophozoites with trypsin (FIG. 3). Giardia parasite clones WB-9B10, WB-1267 and GS-H7 (expressing, respectively, the VSP9B10, VSP1267 and VSPH7 VSPs) were resuspended in PBS at pH 7.4 and treated for 90 min at 37° C. with variable concentrations of trypsin (200 μg/mL and 2 mg/mL). Then, the parasites were lysed and equivalent protein amounts were applied to each lane in the SDS-PAGE gels. FIG. 3 shows that the three VSPs tested were able to survive exposure to trypsin.

These results demonstrated that VSPs are resistant to chemical and proteolytic degradation and can survive environmental conditions similar to those found in the upper portions of the GIT.

Example 2 VSP Attachment to Enteric Mucosa after Oral Administration

To determine whether VSPs were capable of attaching to the enteric mucosa after oral administration, in vivo assays were conducted in gerbils. A group of gerbils was infected with Giardia parasite clone WB-9B10 trophozoites (FIG. 4A), a second group was not infected (FIG. 4B), and a third group of gerbils was immunized with the entire repertoire of VSPs purified from transgenic trophozoites (FIG. 4C). Tissue sections from each group were incubated with the anti-VSP9B10 monoclonal antibody, detected with anti-mouse immunoglobulins labeled with horseradish peroxidase, developed with 3,3′ diaminobenzidine, and counterstained with hematoxylin/eosin.

A strong difference on the level of staining of the surface of the gut epithelial cells between infected or immunized (FIG. 4A, FIG. 4C) compared to non-infected animal (FIG. 4B) was observed, indicating that VSPs remained attached to the enteric mucosa after oral administration.

These results, together with the results of Example 1 indicated that VSPs survived pH and enzymatic conditions in the GIT and successfully attached to gut epithelial cells. These physicochemical properties would allow VSPs to shuttle drugs through the GIT, and the prolonged stay in the GIT should allow the passage of drugs carried by the VSPs from the GIT to the bloodstream.

Example 3 Recombinant Production of VSP1267 VSP Carrier

To obtain the VSP carrier to be used for the oral administration experiments, a modified VSP protein was designed and recombinantly produced. The full-length VSP contains a signal peptide, a cysteine-rich extracellular region containing numerous CXXC motifs, a transmembrane region, and short cytoplasmic tail (FIG. 1A). A DNA construct was generated in which the transmembrane region and the cytoplasmic 5 residues of the VSP1267 were eliminated and a His6 protein purification tag was added at the carboxy terminal (FIG. 5A) (SEQ ID NO:1). The signal sequence is underlined in FIG. 5A. The amino acids in the His6 protein purification tag are show in a box in FIG. 5A.

Initially, the VSP carrier was recombinantly expressed in E. coli BL21 using the pET28 expression vector (Novagen). Protein production was subsequently improved by codon optimization of the recombinant DNA sequence for expression in baculovirus. Heterologous VSP production was performed by cloning the VSP DNA fragment that codify the VSP1267 variant (FIG. 5A) (SEQ ID NO:1), after codon optimization of the recombinant DNA sequence for expression in Sf9 insect cells using the baculovirus expression system. The protein was expressed from the cell culture supernatant and purified by one step affinity purification in a Nickel Sepharose column using the His6 tag present in the carboxy terminal portion of the protein (FIG. 5B). The results showed that the eluted VSP is highly purified.

Example 4 Sensitivity of Commercial Insulins to Trypsin

To test in vitro the capacity of VSP carriers to protect bioactive peptides from degradation, the capacity of recombinant VSP1267 to protect insulin from conditions similar to those present in the GIT was evaluated. Natural insulin is a bioactive peptide with a molecular mass of 5.8-6 kDa. Prior to evaluating the capacity of the VSP to protect insulin from in vivo degradation in the GIT, the sensitivity of two commercial insulins to proteolysis by trypsin (a highly purified pancreatic protease) and pancreatine (a commercial mixture of hydrolytic pancreatic enzymes) was tested in vitro.

Two types of commercial insulin were tested:

    • LANTUS®: Insulin Glargine (Sanofi-Aventis). Differs from natural human insulin in that the amino acid asparagine at position A21 is replaced by glycine and two arginines are added to the C-terminus of the B-chain, MW: 6,063 kDa). It is long-acting insulin.
    • NOVORAPID®: Insulin Aspart (Novo/Nordisk). Differs from human insulin in that the amino acid, B28, which is normally proline, is substituted with an aspartic acid residue). It is fast acting insulin.

The proteolytic profiles of NOVORAPID® and LANTUS® after preincubation of the insulins with trypsin at 100, 150, 200, 500 and 1000 μg/mL, and pancreatine at enzyme:substrate ratios of 1:1 and 1:2 are shown in FIG. 6. The insulins and their degradation products were visualized using silver staining. LANTUS® insulin was not easily degraded in the assayed experimental conditions. However, for NOVORAPID®, a trypsin dose-dependent increase in proteolytic degradation was observed.

Example 5 In Vivo Capacity of VSPs to Protect Insulin from Degradation

The combination of insulin with the VSP carrier VSP1267 was assayed to determine whether the VSP can (i) protect insulin from degradation when administered orally and (ii) promote its systemic biological action, namely the regulation of blood glucose levels. Accordingly, a sub-optimal oral dose of insulin was first determined, and then it was determined whether the combination of insulin at this sub-optimal dose with the VSP carrier could promote insulin's biological action (see FIGS. 7A and 7B). The biological activity of insulin was measured by testing its hypoglycemic capacity. Accordingly, blood glucose levels were quantified in female Balb/c 7 week-old mice left without food intake for 2 hours. After the starvation period, the mice received 1 IU, 5 IU and 50 IU oral doses of LANTUS® (FIG. 7A) or NOVORAPID® (FIG. 7B). Blood glucose levels were determined at the indicated time points. Blood glucose levels were also quantified after subcutaneous administration of 1-5 IU of insulin as a positive control. These experiments indicated that 1 IU of insulin was a sub-optimal oral dose that could be used for the follow up experiments testing the administration of insulin in combination with a VSP carrier (see FIG. 8A and FIG. 8B).

The results shown in FIGS. 8A and 8B demonstrate that the administration of insulin in combination with a VSP carrier promotes insulin action when administered by the oral route. In this experiment, female Balb/c mice, 7 week-old were left without food intake for 2 hours and then received doses of insulin, LANTUS® (FIG. 8A) and NOVORAPID® (FIG. 8B), at the suboptimal dose identified in FIG. 7 (1 IU) in three different formulations (i) insulin administered alone, (ii) insulin combined with VSP at a 1:1 ratio, and (iii) insulin combined with VSP at a 1:3 ratio. PBS and a subcutaneous administration of insulin at 1-5 IU were used as controls. The combination of 1 IU of insulin with VSPs enhanced insulin's biological action, at a 1:1 insulin/VSP ratio for LANTUS® and at a 1:3 insulin/VSP ratio for NOVORAPID® (circled).

Example 6 In Vitro Protection of Human Growth Hormone (hGH) by the VSP1267 VSP Carrier

To evaluate in vitro the capacity of a VSP carrier to protect bioactive peptides from degradation, we evaluated the capacity of recombinant VSP1267 to protect human growth hormone (Somatotropin, hGH) (Biosidus, Argentina), an 191 amino acids long protein, from conditions similar to those present in the GIT. Similar to the previous analysis performed with the VSPs alone, the capacity of the VSP to protect hGH from degradation caused by extreme pHs or by enzymatic proteolysis was assayed.

First, the specificity of the anti-hGH monoclonal antibody (αhGH) was determined by Western blotting (FIG. 9). Two dilutions of the monoclonal antibody αhGH (1/3000 and 1/2000), as well as a control anti-alkaline phosphatase antibody (αMouse-AP) were used to detect hGH (recombinant human growth hormone produced in E. coli). The αhGH monoclonal antibody recognized only one band of the correct molecular weight of hGH (22.1 KDa). Different amounts of hGH (0.25, 0.5, 1, 5 and 10 μg) were used. The αhGH specific monoclonal antibody was capable of detecting very low amounts of hormone at very high dilutions. The anti-mouse antibody used as control showed no reaction.

The anti-hGH monoclonal antibody was subsequently used to determine the degree of resistance of hGH to different pHs. hGH was incubated at different pHs (1.6, 2.0, 3.8, 5.0, 5.8, 7.0, 8.0, 9.0, 10.0, and 11.0) for 90 minutes. The Western blot results shown in the top panel of FIG. 10A as well as the silver staining detection of the hormone shown in the bottom panel of FIG. 10A, indicated that at higher pHs hGH remained unaltered as compared with the control. The hormone suffered auto-proteolytic processing at slightly acidic pHs that did not interfere with the recognition of anti-GH antibody (see, e.g., Such-Sanmartin et al., Growth Factors 27:255-64 (2009)). However, at very low pHs (similar to those found in the stomach) part of the hormone was highly degraded (FIG. 10A, circles).

When a VSP carrier was added to hGH at a 3:1 VSP/hGH ratio and the mixtures were incubated at different pHs (1.4, 1.96, 3.8, 4.91, 5.9, 7.01, 7.95, 8.51, 9.61 and 11.17), no significant changes respect to the hGH degradation levels of hGH in the absence of VSP were observed (FIG. 10B).

hGH was also treated for 90 min at 37° C. with several concentrations of trypsin (0, 100, 150, 200, and 500 μg/mL). The Western blot results shown in the top panel of FIG. 11A as well as the silver staining detection of the hormone shown in the bottom panel of FIG. 11A indicated that the hormone was rapidly degraded even at the lowest protease concentrations. VSP addition at a 3:1 ratio was able to protect hGH from trypsin degradation (FIG. 11B). This protective effect was observed up to a 150 μg/mL trypsin concentration.

Example 7 In Vivo Protection of Human Growth Hormone (hGH) Administered in Combination with a VSP Carrier

hGH serum levels were tested after oral administration, evaluating different doses and measurement times, to determine the best dose for combination with the VSP carrier VSP1267 (FIG. 11A). As in previous experiments, female Balb/c mice, 7 weeks old, were left without food intake for 2 hours and then received the doses indicated in FIG. 12A (i.e., 50, 100, 200, 400 and 800 μg of hGH). In a parallel experiment, hGH was administered subcutaneously (FIG. 11A, inset). It was observed that hGH alone is absorbed orally, at much lower levels than subcutaneously absorption (FIG. 11A, main panel). However, this oral absorption was highly variable regarding both times and amounts. Thus, a direct relationship between absorption and these variables (time and concentration) could not be determined. Despite these results, we used a dose of 50 μg to evaluate the effect of combination of hGH with the VSP carrier.

FIGS. 12A and 12B show a time response drawing showing serum hGH levels in female Balb/c mice, 7 weeks-old, that were left without food intake for 2 hours and then received a 50 μg dose of hGH in combination with a VSP carrier. Oral administration of hGH:VSP at a 1:3 ratio (50 μg of hGH combined with 150 μg of VSP) enhanced the hGH absorption when compared to the oral administration of hGH alone without a VSP carrier.

Example 8 In Vitro and In Vivo Protection of Parathormone in Combination with a VSP Carrier

Parathyroid hormone (PTH), parathormone or parathyrin, is secreted by the chief cells of the parathyroid glands as a polypeptide containing 84 amino acids. It acts to increase the concentration of calcium (Ca2+) in the blood, whereas calcitonin (a hormone produced by the parafollicular cells (C cells) of the thyroid gland) acts to decrease calcium concentration. PTH acts to increase the concentration of calcium in the blood by acting upon the parathyroid hormone 1 receptor (high levels in bone and kidney) and the parathyroid hormone 2 receptor (high levels in the central nervous system, pancreas, testis, and placenta). PTH half-life is approximately 4 minutes. It has a molecular mass of 9.4 kDa. A low level of PTH in the blood is known as hypoparathyroidism. Causes include surgical misadventure (e.g., inadvertent removal during routine thyroid surgery), autoimmune disorder, and inborn errors of metabolism. Hypoparathyroidism can be treated, e.g., with synthetic PTH 1-34 (Tireparatide). PTH can be measured in the blood in several different forms: intact PTH; N-terminal PTH; mid-molecule PTH, and C-terminal PTH, and different tests are used in different clinical situations.

To assess in vitro the capacity of VSP carriers to protect parathormone from degradation, the capacity of a VSP carrier (e.g., VSP carrier VSP1267) to protect human parathormone from conditions similar to those present in the GIT will be evaluated. The capacity of the VSP to protect parahormone from degradation caused by extreme pHs or by enzymatic proteolysis (e.g., by trypsin and/or pancreatine) will be assayed using the methods described in the Examples above.

Parathormone alone or mixed with VSP carrier will be incubated at different pHs or with different concentration of proteolytic enzymes such as trypsin. The presence of parathormone after the pH and proteolyitc enzyme challenges will be detected using an anti-parathormone monoclonal antibody.

Experimental results will show whether the combination of a VSP carrier with parathormone increases the resistance of parathormone to proteolysis and to pH-induced degradation.

In vivo assays to determine whether oral administration of parathormone in combination with a VSP carrier protects parathormone from the conditions in the GIT and results in increased absorption with respect to parathormone orally administered without a VSP carrier will be performed using the methods described in previous Examples. E.g., parathormone serum levels will be measured at different times after the oral administration of parathormone (alone or in combination with a VSP carrier) to mice at different doses, and parathromone/VSP ratios. The result will indicate whether absorption of parathormone and parathromone serum levels are increased when parathormone is administered in combination with a VSP carrier as compared to the oral administration of parathormone alone without a VSP carrier.

Example 9 In Vitro and In Vivo Protection of Interleukin 2 (IL-2) in Combination with a VSP Carrier

In preliminary experiments, VSP-IL-2 fusion proteins were produced in which IL-2 was genetically fused to a VSP. One of these recombinant proteins comprised a VSP C-terminally fused to IL-2. In a second recombinant construct, VSP was C-terminally fused to IL-2 via a linker interposed between the C-terminus of the VSP and the N-terminus of IL-2.

Interleukin-2 (IL-2) is an interleukin, a type of cytokine signaling molecule in the immune system. It is a protein that attracts white blood cells (lymphocytes of leukocyte), the cells that are responsible for immunity. It is part of the body's natural response to microbial infection, and in discriminating between foreign (non-self) and self. IL-2 mediates its effects by binding to IL-2 receptors, which are expressed by lymphocytes. IL-2 has been tested in many clinical trials as an immunotherapy for the treatment of cancers, chronic viral infections and as adjuvants for vaccines. A recombinant form of IL-2 for clinical use is manufactured by Prometheus Laboratories Inc with the brand name Proleukin. It has been approved by the Food and Drug Administration (FDA) for the treatment of cancers (malignant melanoma, renal cell cancer), and is in clinical trials for the treatment of chronic viral infections, and as a booster (adjuvant) for vaccines.

To assess in vitro the capacity of VSP carriers to protect IL-2 from degradation, the capacity of a VSP carrier (e.g., recombinant VSP1267) to protect human IL-2 from conditions similar to those present in the GIT was evaluated. The capacity of the VSP to protect IL-2 from degradation caused by extreme pHs or by enzymatic proteolysis (e.g., by trypsin and/or pancreatine) was assayed using the methods described in the Examples above.

IL-2 alone or mixed with VSP carrier was incubated at different pHs or with different concentration of proteolytic enzymes such as trypsin. The presence of IL-2 after the pH and proteolyitc enzyme challenges was detected using Coomassie stain of SDS-PAGE gels. The experimental results showed that the combination of a VSP carrier with IL-2 increases the resistance of IL-2 to proteolysis and to pH-induced degradation (FIG. 15A-C).

In vivo assays to determine whether oral administration of IL-2 in combination with a VSP carrier protects IL-2 from the conditions in the GIT and results in increased absorption with respect to IL-2 orally administered without a VSP carrier will be performed using the methods described in previous Examples. E.g., IL-2 serum levels will be measured at different times after the oral administration of IL-2 (alone or in combination with a VSP carrier) to mice at different doses, and IL-2/VSP ratios. Biological effects of IL-2 will be assessed by monitoring in regulatory T cells numbers/frequencies as well as expression of CD25 on Treg. The result will indicate whether absorption of IL-2 and (i) IL-2 serum levels are increased, (ii) and/or Treg numbers/frequencies is increased, (iii) and/or CD25 molecule expression detected by mean fluorescent intensity of staining using flow cytometry is increased, when IL-2 is administered in combination with a VSP carrier as compared to the oral administration of IL-2 alone without a VSP carrier.

Example 10 In Vitro and In Vivo Protection of Interleukin 10 (IL-10) in Combination with a VSP Carrier

Interleukin-10 (IL-10 or IL10), also known as human cytokine synthesis inhibitory factor (CSIF), is an anti-inflammatory cytokine. In humans IL-10 is encoded by the IL10 gene. IL-10 is capable of inhibiting synthesis of pro-inflammatory cytokines such as IFN-γ, IL-2, IL-3, TNFα and GM-CSF made by cells such as macrophages and regulatory T-cells. It also displays a potent ability to suppress the antigen-presentation capacity of antigen presenting cells. However, it is also stimulatory towards certain T cells and mast cells and stimulates B cell maturation and antibody production.

To assess in vitro the capacity of VSP carriers to protect IL-10 from degradation, the capacity of a VSP carrier (e.g., recombinant VSP1267) to protect human IL-10 from conditions similar to those present in the GIT was evaluated. The capacity of the VSP to protect IL-10 from degradation caused by extreme pHs or by enzymatic proteolysis (e.g., by trypsin and/or pancreatine) was assayed using the methods described in the Examples above.

IL-10 alone or mixed with VSP carrier was incubated at different pHs or with different concentrations of proteolytic enzymes such as trypsin. The presence of IL-10 after the pH and proteolyitc enzyme challenges was detected using Coomassie Blue staining of SDS-PAGE gels. Experimental results showed that the combination of a VSP carrier with IL-10 increased the resistance of IL-10 to proteolysis and to pH-induced degradation (FIG. 15A-C). These results showed that IL-10 and IL-2 (discussed in the previous example) in the presence of VSP are resistant to low pH and to the proteolytic action of trypsin. For example, none of the two interleukins tested digested by trypsin, even at 1:10 ratios, or degrade after incubation at pH 2. This is consistent with the observation that VSP carriers can protect other bioactive peptides, such as LANTUS™ insulin. Accordingly, the combination of VSPs with interleukins, e.g., IL-2 or IL-10, could facilitate their intestinal absorption and their systemic effects.

In vivo assays to determine whether oral administration of IL-10 in combination with a VSP carrier protects IL-10 from the conditions in the GIT and results in increased absorption with respect to IL-10 orally administered without a VSP carrier will be performed using the methods described in previous Examples. E.g., IL-10 serum levels will be measured at different times after the oral administration of IL-10 (alone or in combination with a VSP carrier) to mice at different doses, and IL-10/VSP ratios. The results will indicate whether absorption of IL-10 and IL-10 serum levels are increased when IL-10 is administered in combination with a VSP carrier as compared to the oral administration of IL-10 alone without a VSP carrier.

Example 11 In Vitro and In Vivo Protection of Glucagon in Combination with a VSP Carrier

Glucagon, a peptide hormone secreted by the pancreas, raises blood glucose levels. Its effect is opposite that of insulin, which lowers blood glucose levels. Glucagon is a 29-amino acid polypeptide. Its primary structure in humans is HSQGTFTSDYSKYLDSRRAQDFVQWLMNT (SEQ ID NO:6). The polypeptide has a molecular weight of 3,485 daltons. Glucagon administration is vital first aid in cases of severe hypoglycemia when the victim is unconscious or for other reasons cannot take glucose orally. Glucagon is given by intramuscular, intravenous or subcutaneous injection, and quickly raises blood glucose levels. The reconstitution process makes using glucagon cumbersome (Meeran et al., Endocrinology 140(1):244-50 (1999); Longuet et al., Cell Metab. 8(5):359-71 (2008)).

To assess in vitro the capacity of VSP carriers to protect glucagon from degradation, the capacity of a VSP carrier (e.g., recombinant VSP1267) to protect human glucagon from conditions similar to those present in the GIT was evaluated. The capacity of the VSP to protect glucagon from degradation caused by enzymatic proteolysis by trypsin was assayed using the methods described in the Examples above.

Glucagon (1 μg) alone or mixed with VSP carrier was incubated for 1 hour at 37° C. at different pHs or with different concentrations of proteolytic enzymes such as trypsin at 37° C. (FIG. 13A). The reaction was stopped by addition of a protease inhibitor cocktail without EDTA (COMPLETE™, EDTA-free, Roche Diagnostic). The presence of glucagon after the pH and proteolyitc enzyme challenges was detected using an anti-glucagon monoclonal antibody. Experimental results showed that the combination of a VSP carrier with glucagon increased the resistance of glucagon to trypsin proteolysis and to pH-induced degradation. The upper panel of FIG. 13A shows a dot blot analysis showing demonstrating the sensitivity of glucagon to the action of trypsin. The lower panel of FIG. 13A shows that combining a VSP carrier with glucagon at a 1:3 glucagon to VSP ratio protected glucagon from trypsin degradation up to 1:2 (protein:protease) ratio. The Dot blot shows pairs of samples in which glucagon samples without a VSP carrier, or with a VSP carrier at a 1:3 glucagon to VSP carrier ratio were subjected to the same trypsin concentrations.

The glucagon used in these assays was a recombinant polypeptide hormone (r-Glucagon, Lilly) marketed by Eli Lilly Co. A previous study performed using Peptide Cutter software (available at web.expasy.org/cgi-bin/peptide_cutter/peptidecutter.pl) indicated that glucagon was very sensitive to the action of the protease trypsin, as shown in FIG. 13A. Preliminary experiments also demonstrated that the monoclonal antibody anti-glucagon (Sigma-Aldrich Cat. No. G2654 is able to detect 1 μg of glucagon by dot blot.

FIG. 13B shows that VSP promotes the biological action of glucagon when glucagon is co-administered orally. Effect of oral administration of glucagon was evaluated in BALC/c mice of 7 weeks of age, which were left without food intake for 2 hs and then received the indicated doses of glucagon alone or combined with VSP. The blood glucose levels were determined at the indicated times. The combination of 50 μg glucagon with VSPs (150 μg) appears to increase the biological action of glucagon when it is administrated orally, respect to the oral administration of glucagon alone. Moreover, from the in vivo test is remarkable to note that the animals that have received an oral administration of glucagon plus VSP their glucose levels increased more quickly (15 minutes) respect to the animals with subcutaneous (S.C) inoculation (30 minutes), and the effect of the group glucagon-VSP oral was maintained greater amount of time respect to the s.c. group.

In vivo assays to determine whether oral administration of glucagon in combination with a VSP carrier protects glucagon from the conditions in the GIT and results in increased absorption with respect to glucagon orally administered without a VSP carrier were performed using the methods described in previous Examples. Glucagon serum levels were measured at different times after the oral administration of glucagon (alone or in combination with a VSP carrier) to mice at different doses, and glucagon/VSP ratios (FIG. 13B).

In particular, the effect of oral administration of glucagon was evaluated in BALC/c mice of 7 weeks of age, which were left without food intake for 2 hours and then received the indicated doses of glucagon alone or combined with VSP. The blood glucose levels were determined at the indicated times. The combination of 50 μg glucagon with VSPs (150 μg) appeared to increase the biological action of glucagon when it was administrated orally, respect to the oral administration of glucagon alone. Moreover, from the in vivo test is was remarkable to observe that the animals that have received an oral administration of glucagon plus VSP saw their glucose levels increase more quickly (15 minutes) with respect to the animals that underwent subcutaneous (S.C) inoculation (30 minutes). The effect observed on the group receiving glucagon-VSP orally was maintained for greater amount of time with respect to the group receiving the composition subcutaneously.

Example 12 Delivery of Poorly Soluble Small Molecule Drugs in Combination with VSP Carriers

To assess in vitro the capacity of VSP carriers to effectively deliver poorly soluble therapeutic agents (e.g., poorly soluble small molecule drugs such as glipizide, a poorly water-soluble BCS class II antidiabetic drug; amikacin, an aminoglycoside antibiotic; or vancomycin, a glycopeptide antibiotic), the capacity of a VSP carrier (e.g., recombinant VSP1267) to protect the poorly soluble therapeutic agent from conditions similar to those present in the GIT will be first evaluated. The capacity of the VSP to protect the poorly soluble therapeutic agent from degradation caused by extreme pHs will be assayed using methods known in the art. For example, the therapeutic agent in combination with a VSP carrier will be subjected to pH levels similar to those present in the GIT, and the degradation of the drug will be monitored using mass spectrometry or chromatographic methods such as HPLC. Additionally, the capacity of the VSP to solubilize the therapeutic can be measured by methods known in the art. Experimental results will show whether the combination of a VSP carrier with the poorly soluble therapeutic agent increases the therapeutic agent's solubility while protecting it from degradation by conditions similar to those present in the GIT.

In vivo assays to determine whether oral administration of the poorly soluble therapeutic agent in combination with a VSP carrier effectively keeps the therapeutic agent in solution, protects the therapeutic agent from the conditions in the GIT, and results in increased absorption with respect to the therapeutic agent administered without a VSP carrier will be performed using the methods described in previous Examples and methods known in the art. The results will indicate whether combining the therapeutic agent with a VSP can maintain the therapeutic agent in solution, protect in from the conditions in the GIT, and increase the absorption of the therapeutic agent and its serum levels when compared to the oral administration of poorly soluble therapeutic agent alone without a VSP carrier.

Example 13 VSP-Like Domains Present in Other Organisms Possess the Same Properties that the Giardia VSPs

Alignment of the sequence of the extracellular domain of the Giardia VSP1267, used herein as an exemplary VSP carrier, with other VSP-like molecules sequences led to the identification of multiple CXXC motifs in proteins belonging to Paramecium, Tetrahymena, Entamoeba species, among others. Thus, representative fragments of primary sequences of surface kinases of Entamoeba sp., and surface proteins of Paramecium sp. and Tetrahymena sp. predict a conserved domain containing CXXC motifs in a VSP-like architecture as responsible for resistance to pH, temperature and proteolytic digestion.

To determine if VSP-like proteins retain the Giardia VSP extracellular domain properties, and therefore can be used as VSP carriers or as components of chimeric VSP proteins, a DNA fragment of a Tetrahymena thermophila VSP-like protein encoding a VSP domain (TTHERM_00826790 hypothetical protein; SEQ ID NO: 590) was modified using stander molecular biology techniques to generate a chimeric VSP. The chimeric VSP protein (SEQ ID NO: 589) comprised the sequences encoding the signal peptide (SEQ ID NO: 591) of Giardia intestinalis VSP1267 and a His6 purification tag fused respectively to the amino terminus and carboxy terminus of the sequence of a VSP domain (SEQ ID NO: 592) located between amino acid positions 977 and 1465 of the VSP-like protein from Tetrahymena (SEQ ID NO: 590). The sequence of the resulting chimeric VSP is shown in FIG. 14A.

The chimeric VSP was cloned into a bacmid for expression in Sf9 insect cells. Once expressed and secreted to the culture supernatant, the chimeric VSP protein was purified on a Nickel column as described in Example 2.

The chimeric VSP protein was used to verify the stability of hGH to pH and trypsin sensitivity. FIG. 14B shows the activity of different concentration of trypsin on recombinant hGH, as detected by Western blotting using the anti-hGH monoclonal antibody. A ratio of hormone:protease of 1:25 showed the best results to determine pH and proteolytic degradation.

FIG. 14C shows that combination of hGH with the chimeric VSP protein derived from T. thermophila and G. intestinalis fragments was able to protect hGH from degradation at low pH and trypsin, as demonstrated in a Coomassie Blue staining after SDS-PAGE and Western blotting using an anti-hGH monoclonal antibody.

These results indicated, for example, that:

    • (a) polypeptides containing multiple CXXC motifs from species other than Giardia possess the capability to protect peptides from degradation by low pH and/or protease activity, which could favor absorption in the intestine of mammals;
    • (b) it is possible to generate VSP carriers by using a fragment from a larger protein comprising one or several VSP domains;
    • (c) it is possible to generate VSP carriers by combining fragments from two different VSP proteins, in this case, the signal sequence from a VSP protein and a VSP domain from a VSP-like protein;
    • (d) it is possible to generate a VSP carrier by combining fragments from proteins from two different organisms, in this case, a sequence from Giardia intestinalis and a sequence from Tetrahymena thermophila;
    • (e) it is possible to generate VSP carriers using VSP proteins that may be too large for successful recombinant expression (e.g., the 2,192 amino acids long TTHERM_00826790 protein) by excising a portion of the larger VSP protein containing a computationally identified VSP domain (e.g., the 489 amino acid long VSP domain fragment used in the instant example).

The present invention has been described above with the aid of functional building blocks illustrating the implementation of specified functions and relationships thereof. The boundaries of these functional building blocks have been arbitrarily defined herein for the convenience of the description. Alternate boundaries can be defined so long as the specified functions and relationships thereof are appropriately performed.

The foregoing description of the specific embodiments will so fully reveal the general nature of the invention that others can, by applying knowledge within the skill of the art, readily modify and/or adapt for various applications such specific embodiments, without undue experimentation, without departing from the general concept of the present invention. Therefore, such adaptations and modifications are intended to be within the meaning and range of equivalents of the disclosed embodiments, based on the teaching and guidance presented herein. It is to be understood that the phraseology or terminology herein is for the purpose of description and not of limitation, such that the terminology or phraseology of the present specification is to be interpreted by the skilled artisan in light of the teachings and guidance.

The breadth and scope of the present invention should not be limited by any of the above-described exemplary embodiments, but should be defined only in accordance with the following claims and their equivalents.

Claims

1-60. (canceled)

61. A therapeutic composition comprising a VSP (Variant-specific Surface Protein) carrier or VSP-like carrier and a bioactive peptide, wherein

(i) the VSP carrier or VSP-like carrier can bind to the bioactive peptide;
(ii) the VSP carrier or VSP-like carrier is not covalently bound to the bioactive peptide via a peptidic bond;
(iii) the bioactive peptide is therapeutically effective after binding to the VSP carrier or VSP-like carrier;
(iv) the binding of the VSP carrier or VSP-like carrier to the bioactive peptide increases the resistance of the bioactive peptide to pH-mediated and/or enzymatic degradation compared to the resistance of the same bioactive peptide not bound to said VSP carrier or VSP-like carrier; and,
(v) the bioactive peptide is not a vaccine immunogen.

62. The therapeutic composition of claim 61, wherein the bioactive peptide is a cytokine or a peptide hormone.

63. The therapeutic composition of claim 62, wherein the cytokine is an interleukin.

64. The therapeutic composition of claim 63, wherein the interleukin is interleukin-2 (IL-2) or interleukin-10 (IL-10).

65. The therapeutic composition of claim 63, wherein the cytokine is an interferon.

66. The therapeutic composition of claim 61, wherein the VSP carrier is a VSP from Giardia.

67. The therapeutic composition of claim 61, wherein the VSP-like carrier is a VSPs-like protein from Tetrahymena, Entamoeba, or Paramecium.

68. The therapeutic composition of claim 61, formulated for oral or mucosal administration.

69. The therapeutic composition of claim 61, wherein the VSP carrier comprises the extracellular domain of a VSP from Giardia or a fragment thereof.

70. The therapeutic composition of claim 61, wherein the VSP-like carrier comprises the extracellular domain of a VSP-like protein from Tetrahymena or a fragment thereof.

71. The therapeutic composition of claim 61, wherein the VSP-like carrier comprises the extracellular domain of a VSP-like protein from Paramecium or a fragment thereof.

72. The therapeutic composition of claim 61, wherein the VSP-like carrier comprises the extracellular domain of a VSP-like protein from Entamoeba or a fragment thereof.

73. The therapeutic composition of claim 61, wherein the VSP carrier or VSP-like carrier further comprises a protein purification tag sequence.

74. The therapeutic composition of claim 62, wherein peptide hormone is insulin, human growth hormone, glucagon, or parathormone.

75. The therapeutic composition of claim 61, wherein the molecule to molecule ratio of VSP carrier or VSP-like carrier to the bioactive peptide ranges from about 10:1 to about 1:10.

76. A pharmaceutical composition comprising the therapeutic composition of claim 61 and a pharmaceutically acceptable excipient.

77. A method of delivering a bioactive peptide to a target location in a subject in need thereof comprising orally administering the therapeutic composition of claim 61 to the subject.

78. A method of treating a disease or condition in a subject in need thereof comprising orally administering an effective amount of the therapeutic composition of claim 61 to the subject.

79. A method of treating a disease or condition in a subject in thereof comprising combining a VSP carrier or VSP-like carrier and a bioactive peptide, wherein

(i) the VSP carrier or VSP-like carrier can bind to the bioactive peptide;
(ii) the VSP carrier or VSP-like carrier is not covalently bound to the bioactive peptide via peptidic bonds;
(iii) the bioactive peptide is therapeutically effective after binding to the VSP carrier, wherein the binding of the VSP carrier or VSP-like carrier to the bioactive peptide increases the resistance of the bioactive peptide to pH-mediated and/or enzymatic degradation compared to the resistance of the same bioactive peptide not bound to said VSP carrier or VSP-like carrier; and,
(iv) the bioactive peptide is a cytokine or a peptide hormone.

80. A method of making an orally deliverable composition comprising combining a VSP carrier or VSP-like carrier and a bioactive peptide, wherein

(i) the VSP carrier or VSP-like carrier can bind to the bioactive peptide;
(ii) the VSP carrier or VSP-like carrier is not covalently bound to the bioactive peptide via peptidic bonds;
(iii) the bioactive peptide is therapeutically effective after binding to the VSP carrier, wherein the binding of the VSP carrier or VSP-like carrier to the bioactive peptide increases the resistance of the bioactive peptide to pH-mediated and/or enzymatic degradation compared to the resistance of the same bioactive peptide not bound to said VSP carrier or VSP-like carrier; and,
(iv) the bioactive peptide is a cytokine or a peptide hormone.
Patent History
Publication number: 20180228913
Type: Application
Filed: Aug 9, 2017
Publication Date: Aug 16, 2018
Inventors: David KLATZMANN (Paris), Eliane PIAGGIO (Paris), Hugo LUJAN (Cordoba)
Application Number: 15/673,037
Classifications
International Classification: A61K 47/64 (20060101); A61K 38/26 (20060101); A61K 38/27 (20060101); A61K 38/20 (20060101); A61K 38/29 (20060101); A61K 38/28 (20060101); A61K 47/42 (20060101); C07K 14/44 (20060101);