COMPOSITIONS, KITS AND METHODS FOR TREATMENT OF COMPLEMENT-RELATED DISORDERS
Methods, compositions and kits for regulating complement activity or treating a complement activity disorder in a subject using soluble, membrane-independent CD59 protein, methods of assaying human macular degeneration (MD), and methods and kits for assaying potential therapeutic agents for treatment of human MD are provided herein.
This application is a continuation of U.S. patent application Ser. No. 13/766,142, filed Feb. 13, 2013, now U.S. Pat. No. 10,351,617, which is a continuation of International Patent Application No. PCT/US11/047761, filed Aug. 15, 2011, which claims the benefit of priority to U.S. Provisional Patent Application Ser. No. 61/373,596, filed Aug. 13, 2010.
GOVERNMENT SUPPORTThis invention was made with government support under grant numbers EY014991 and EY013837 awarded by the National Institutes of Health. The government has certain rights in the invention.
TECHNICAL FIELDMethods, compositions and kits for regulating complement activity or treating a complement activity disorder in a subject, methods for making a composition for treating a complement activity disorder in a subject, and methods and kits for assaying potential therapeutic agents for treatment of human MD are provided herein.
BACKGROUNDAge-related macular degeneration (AMD) is a disease associated with aging that gradually destroys sharp, central vision, and is the leading cause of blindness in the elderly (Klein et al. 2007 Ophthalmology 114: 253-262). The macula is a specific tissue located in the center of the retina, the light-sensitive tissue at the back of the eye that converts light or an image into electrical impulses.
AMD is classified as either wet or dry (Inana et al. U.S. Pat. No. 7,309,487 issued Dec. 18, 2007). Wet AMD is characterized by growth of abnormal blood vessels behind the retina under the macula. These new blood vessels are fragile and often leak blood and fluid.
The blood and fluid raise the macula from its not I 'tat place at the back of the eye, causing loss of central vision. Wet AMD is treated with laser surgery, photodynamic therapy, and injections into the eye. None of these treatments, however, cures wet AMD, rather the treatments slow progression of the disease. Dry AMD is characterized by slow breakdown of light-sensitive cells in the macula, gradually blurring central vision in the affected eye. Over time, less of the macula functions and central vision is gradually lost. There is no known form of treatment for advanced stage dry AMD, and vision loss is inevitable. A specific high-dose formulation of antioxidants and zinc has been shown to prevent intermediate stage AMD from progressing to advanced AMD.
There is a need for methods of assaying (i.e., prognosticating or diagnosing) human macular degeneration (MD), methods of assaying among chemical entities to identify potential therapeutic agents to treat AMD, and methods of treating a human subject having AMD.
SUMMARYAn aspect of the invention provides a pharmaceutical composition including a nucleotide sequence encoding a membrane-independent CD59 protein and a pharmaceutically acceptable buffer, such that the composition is sufficiently pure for administration to a human subject
In a related embodiments of the pharmaceutical composition, the nucleotide sequence includes
ATGGGAATCCAAGGAGGGTCTGTCCTGTTCGGGCTGCTGCTCGTCCTGGCTGTCTT CTGCCATTCAGGTCATAGCCTGCAGTGCTACAACTGTCCTAACCCAACTGCTGACT GCAAAACAGCCGTCAATTGTTCATCTGATTTTGATGCGTGTCTCATTACCAAAGCT GGGTTACAAGTGTATAACAAGTGTTGGAAGTTTGAGCATTGCAATTTCAACGACG TCACAACCCGCTTGAGGGAAAATGAGCTAACGTACTACTGCTGCAAGAAGGACCT GTGTAACTTTAACGAACAGCTTGAAAATTAA (SEQ ID NO: 5) or a portion or derivative thereof.
In various embodiments, the nucleotide sequence includes at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 99% identity to SEQ ID NO: 5 or a portion or derivative thereof
In a related embodiment of the pharmaceutical composition, the protein includes amino acid sequence
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKA GLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN (SEQ 11) NO: 4) or a portion or derivative thereof. In related embodiments of the pharmaceutical composition, the protein includes an amino acid sequence at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 99% identical to SEQ ID NO: 4.
In a related embodiment, the nucleotide sequence is operably linked to a promoter sequence causing expression of the protein in a cell, and the membrane-independent CD59 protein includes at least one mutation resulting in loss of function of a glycosyl phosphatidyl inositol (GPI) anchoring domain of the encoded CD59 protein. In various embodiments of the pharmaceutical composition, the at least one mutation includes at least one selected from the group of a substitution, a deletion, and an addition. The mutation for example is at an or adjacent to an omega position, whereby the mutation reduces or eliminates the attachment of the GPI anchor or reduces or eliminates the effective functionality of the GPI anchor to attach to a cell membrane.
In a related embodiment, the nucleotide sequence encoding the membrane-independent CD59 protein does not further encode a fusion to a peptide or protein domain that binds to a cell membrane or membrane associated entity.
In a related embodiment, the pharmaceutical composition is formulated sufficiently pure for administration to any mammalian subject, for example a cat, a dog, a cow, a pig, and a bat. In a related embodiment, the pharmaceutical composition is formulated for ocular delivery, for example formulated sterile for delivery in a dose effective to treat macular degeneration or formulated for delivery that is an injection. In various embodiments, the injection includes an intra-ocular injection, subconjunctival injection, or subtenon injection.
In a related embodiment, the pharmaceutical composition is formulated such that the nucleotide sequence is provided in a vector. In a related embodiment, the vector is an engineered viral vector recombinantly linked to the nucleotide sequence encoding the membrane-independent CD59 protein. For example the vector is at least one selected from an adenovirus, an adeno-associated virus, a herpesvirus, a poxvirus, and a lentivirus.
In related embodiments, the pharmaceutical composition is formulated to include a dose of the viral vector particles administered to an affected eye selected from a range of about 107 to about 109; about 108 to about 101°; about 109 to about 1011; about 1011 to about 1012; and about 1011 to about 1013.
In a related embodiment, the vector is a synthetic gene delivery vector for delivery of the nucleotide sequence, for example the synthetic gene delivery vector is selected from: a liposome, a lipid/polycation (LPD), a peptide, a nanoparticle, a gold particle, and a polymer.
In a related embodiment, the pharmaceutical composition further includes a pharmaceutically acceptable salt and a pharmaceutically acceptable emollient. In a related embodiment, the pharmaceutical composition is provided as an eye drop or an ointment. In a related embodiment, the pharmaceutical composition having sufficient purity to administer to a human, is formulated to be administered by at least one route selected from the group of: intravenous, intramuscular, intraperitoneal, intradermal, intrapulmonary, intravaginal, rectal, oral, buccal, topical, sublingual, intranasal, ocular, intraocular, and subcutaneous.
In related embodiments, the pharmaceutical composition further includes at least one agent selected from: an anti-tumor, an antiviral, an antibacterial, an anti-mycobacterial, an anti-fungal, an anti-proliferative and an anti-apoptotic.
In a related embodiment, the nucleotide sequence encoding the membrane-independent CD59 includes a deletion encoding at least one amino acid sequence in a GPI anchoring domain. In a related embodiment, the nucleotide sequence encoding the membrane-independent CD59 protein-includes at least one single amino acid alteration resulting in decrease or loss of function of the GPI anchoring domain.
An aspect of the invention provides a method for making a composition for treating a subject for age-related macular degeneration (AMD) in a subject, the method including: providing a cell with a nucleotide sequence encoding a recombinant membrane-independent CD59 protein under conditions such that the cell expresses and secretes the CD59 protein locally, thereby making the composition for treating the subject, such that the composition is sufficiently pure for administration to the human subject.
In a related embodiment of the method, providing the cell with the nucleotide sequence is performed in vivo in the subject including contacting at least one ocular tissue of the subject with the cell, thereby treating the subject for AMD.
In a related embodiment, such that the providing is ex vivo, and the method further includes after providing the cell with the nucleotide sequence, injecting the cell and contacting at least one ocular tissue of the subject with the cell, thereby treating the subject for AMD.
In a related embodiment of the method, the cell is an autologous cell obtained from the subject. Alternatively, the cell is isologous or heterologous.
In related embodiments of the method, the nucleotide sequence is provided in a viral vector, for example the viral vector is derived from a genetically engineered genome of at least one virus selected from the group consisting of an adenovirus, an adeno-associated virus, a herpcsviruts, and a lentivirus.
In a related embodiment of the method, the nucleotide sequence is provided in a synthetic gene delivery vector for example selected from: a liposome, a lipid/polycation (LPD), a peptide, a nanoparticle, a gold particle, and a polymer.
In related embodiments, the contacting is at least one of: subretinal; subconjunctival; subtenon; subcutaneous; intravenous; and intravitreal. In related embodiments, the injecting is at least one of: subretinal; subconjunetival; subtenon; subcutaneous; intravenous; and intravitreal. In related embodiments, the tissue includes at least one tissue selected from: retinal pigment epithelium, retina, choroid, sclera, Bruch's membrane, and choroidal blood vessels.
In a related embodiment of the method, the nucleotide sequence includes SEQ ID NO: 5 or a portion or derivative thereof. In various embodiments of the method, the nucleotide sequence includes at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 99% identity to SEQ ID NO: 5 or a portion or derivative thereof.
The protein in a related embodiment of the method includes amino acid sequence as shown in SEQ ID NO: 4 or a portion or derivative thereof. In related embodiments of the method, the protein includes an amino acid sequence at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 99% identical to SEQ ID NO: 4.
An aspect of the invention provides a method of regulating complement activity or treating a complement activity disorder in a subject, the method including: contacting an affected tissue or organ of the subject at risk for or suffering from the complement activity disorder with a composition including a vector carrying a nucleotide sequence, encoding a membrane-independent human CD59 protein operably linked to a promoter sequence causing expression of the membrane-independent CD59 protein in a cell, such that the membrane-independent CD59 protein includes at least one mutation resulting in loss of function of glycosyl phosphatidyl inositol (GPI) anchoring domain, and such that the CD59 is soluble and is not further engineered to be membrane targeting; and, observing a physiological indicium of the complement activity disorder after contacting, in comparison to an abnormal amount of the physiological indicium observed prior to contacting, such that a decrease after contacting compared to prior to contacting is a positive indication that the affected tissue or organ is treated.
In a related embodiment, the composition is sufficiently pure to administer to a human or to any mammalian subject.
In a related embodiment of the method, the nucleotide sequence includes SEQ ID NO: 5 or a portion or derivative thereof. In various embodiments of the method, the nucleotide sequence includes at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 99% identity to SEQ ID NO: 5 or a portion or derivative thereof.
In a related embodiment of the method, the protein includes amino acid sequence as shown in SEQ ID NO: 4 or a portion or derivative thereof. In related embodiments of the method, the protein includes an amino acid sequence at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 99% identical to SEQ ID NO: 4.
In related embodiments of the method, the affected tissue is selected from: epithelial, endothelial, and vascular. In related embodiments of the method, the affected organ or tissue is selected from: brain, eye, heart, kidney, mouth, throat, lung, stomach, liver, pancreas, knee, leg, hand, and vascular system.
In related embodiments of the method, the disorder is selected from: macular degeneration, age-related macular degeneration, inflammatory bowel disease, thyroiditis, cryoglobulinaemia, foetal loss, organ graft rejection, sepsis, viral infection, fungal infection, bacterial infection, toxic shock syndrome (TSS), membranoproliferative glomerulonephritis, dense deposit disease, peroximal nocturnal hemoglobinurea, lupus nephritis, membranous nephritis, immunoglobulin A nephropathy, goodpasture syndrome, post-streptococcal glomerulonephritis, systemic lupus erythematosus, atypical hemolytic uremic syndrome, systemic lupus erythromatosis, lupus arthritis, rheumatoid arthritis, Sjogren's syndrome, Bebcet's syndrome, systemic sclerosis, Alzheimer's disease, multiple sclerosis, myasthenia gravis, Guillain-Barre syndrome, cerebral lupus, stroke, adult respiratory distress syndrome, chronic obstructive pulmonary disease, cystic fibrosis, haemolytic anaemia, paroxysmal cold haemoglobinuria, paroxysmal nocturnal haemoglobinuria, vasculitis, pemphigus, bullous pemphigoid, phototoxic reactions, psoriasis, anaphylactic shock, allergy, asthma, myocardial infarction, and atherosclerosis. In a related embodiment, the subject is a tissue or organ donor or recipient.
In a related embodiment, the disorder includes macular degeneration, and observing further includes measuring the indication selected from: visual acuity; visual aberrations; and amount of MAC deposition. In a related embodiment, the disorder includes bacterial infection or TSS, and observing further includes measuring the indication selected from: bacterial titer in a tissue or bodily fluid, extent of fever, and extent of inflammation. In a related embodiment, the disorder includes membranoproliferative glomerulonephritis, and observing further includes measuring the indication selected from: serum complement; urine protein; urine nitrogen; urine creatinine; glomerular filtration rate; effective renal blood flow; filtration fraction; and glomerular sieving. In a related embodiment, the disorder includes atherosclerosis, and observing further includes measuring the indication selected from: serum low density cholesterol; serum total cholesterol; angioscopy; and quantitative colorimetric angioscopy.
An aspect of the invention provides a method of assaying a serum complement component for prognosis or diagnosis of macular degeneration (MD), the method including: contacting a first sample of cells to a sample of a serum and measuring resulting lysis, and comparing extent of lysis to that in a second sample of control cells not so exposed to the serum and otherwise identical, such that the serum added to the first sample of cells is obtained from a patient in need of diagnosis for MD and an optional control serum is obtained from a normal subject and added to an optional third sample of cells, such that a greater extent of lysis in the first sample compared to that in the second sample and the optional third sample is an indication of prognosis or diagnosis of MD.
In a related embodiment, the method further involves contacting at least a fourth sample of cells to a candidate therapeutic composition and otherwise identically to the serum and measuring lysis, such that the extent of lysis of the third sample compared to that in the first sample and the second sample is a measure of protection by the candidate composition, thereby assaying for a potential therapeutic agent for efficacy in treatment of macular degeneration.
In a related embodiment, the method further includes prior to contacting with serum, contacting the cells with a vector encoding a gene capable of expressing a recombinant membrane-independent human CD59 (rmihCD59) protein.
In related embodiments of the method, the rrnihCD59 protein lacks a glycosyl phosphatidyl inositol anchoring domain, and such that a decrease in cell lysis in the presence of rmihCD59 compared to absence oflutihCD59 is an indicium of suitability of the patient for treatment of macular degeneration with srCD59.
In a related embodiment of the method, the protein includes amino acid sequence as shown in SEQ Ti) NO: 4 or a portion or derivative thereof. In related embodiments of the method, the protein includes an amino acid sequence at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 99% identical to SEQ ID NO: 4.
In a related embodiment of the method, the vector encoding the gene includes a nucleotide sequences as shown in SEQ ID NO: 5 or a portion or derivative thereof. In various embodiments of the method, the nucleotide sequence includes at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 99% identity to SEQ IL) NO: 5 or a portion or derivative thereof.
An aspect of the invention provides a pharmaceutical composition comprising a membrane-independent CD59 protein as shown in SEQ ID NO: 4; and a pharmaceutically acceptable buffer, wherein the composition is sufficiently pure for administration to a human subject.
In a related embodiment of the pharmaceutical composition, the nucleotide sequence includes SEQ ID NO: 5 or a portion or derivative thereof. In various embodiments, the nucleotide sequence includes at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 99% identity to SEQ ID NO: 5 or a portion or derivative thereof.
In a related embodiment of the pharmaceutical composition, the protein includes amino acid sequence SEQ ID NO: 4 or a portion or derivative thereof. In related embodiments of the pharmaceutical composition, the protein includes an amino acid sequence at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 99% identical to SEQ ID NO: 4.
In a related embodiment of the pharmaceutical composition, the membrane-independent CD59 protein includes at least one mutation resulting in loss of function of a glycosyl phosphatidyl inositol (GPI) anchoring domain of the encoded CD59 protein; the mutation in various embodiments includes at least one selected from the group of: a substitution, a deletion, and an addition.
In a related embodiment, the membrane-independent CD59 protein does not further encode a fusion to a peptide or protein domain that binds to a cell membrane or membrane associated entity.
In a related embodiment, the pharmaceutical composition is formulated sufficiently pure for administration to any mammalian subject for example a horse, a cow, a goat, a dog, and a cat. The pharmaceutical composition in a related embodiment is formulated for ocular delivery. In a related embodiment, the pharmaceutical composition is formulated sterile for delivery in a dose effective to treat macular degeneration for example wet age-related macular degeneration.
In various embodiments, the pharmaceutical composition is formulated for delivery that is an injection, for example intro-ocular injection, subconjunctival injection, or subtenon injection. In related embodiments, the pharmaceutical composition further includes at least one selected from the group of: a liposome, a lipid/polycation (LPD), a peptide, a nanoparticle, a gold particle, and a polymer. For example, the composition further includes a peptide for overall delivery composition.
In related embodiments, the pharmaceutical composition further includes a pharmaceutically acceptable salt and a pharmaceutically acceptable emollient. In a related embodiment, the pharmaceutical composition is provided as an eye drop or an ointment. In a related embodiment, the pharmaceutical composition is a solution that is at least one selected from the group of: buffered, pH neutral, and isotonic.
The pharmaceutical composition is various embodiments is formulated for at least one route selected from the group of: intravenous, intramuscular, intraperitoneal, intradermal, intrapulmonary, intravaginal, rectal, oral, buccal, topical, sublingual, intranasal, ocular, intraocular, and subcutaneous. In various embodiments, the pharmaceutical composition further includes at least one agent selected from the group consisting of: anti-tumor, antiviral, antibacterial, anti-mycobacterial, anti-fungal, anti-proliferative and anti-apoptotic.
In a related embodiment of the pharmaceutical composition, the protein includes a deletion encoding at least one amino acid sequence in a GPI anchoring domain. In a related embodiment, the protein includes at least one single amino acid alteration resulting in decrease or loss of function of the GPI anchoring domain.
An aspect of the invention provides a kit for regulating complement activity or treating a complement activity disorder in a subject, the kit comprising: a pharmaceutical composition including a membrane-independent CD59 protein and/or a nucleotide sequence encoding the CD59 protein, such that the composition is sufficiently pure for administration to the subject; instructions for use; and, a container.
In a related embodiment of the kit, the nucleotide sequence includes SEQ ID NO: 5 or a portion or a derivative thereof. In various embodiments of the kit, the nucleotide sequence includes at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 99% identity to SEQ ID NO: 5 or a portion or derivative thereof.
In a related embodiment of the kit, the protein includes amino acid sequence as shown in SEQ ID NO: 4 or a portion or derivative thereof. In various embodiments of the kit, the protein includes an amino acid sequence at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 99% identical to SEQ ID NO: 4.
In a related embodiment of the kit, the nucleotide sequence is operably linked to a promoter sequence causing expression of the protein in a cell, such that the membrane-independent CD59 protein includes at least one mutation resulting in loss of function of a glycosyl phosphatidyl inositol (GPI) anchoring domain of the encoded CD59 protein. For example, the mutation is at least one selected from the group of: a substitution, a deletion, and an addition.
In a related embodiment, the nucleotide sequence encoding the membrane-independent CD59 protein does not further encode a fusion to a peptide or protein domain that binds to a cell membrane or membrane associated entity.
The kit in various embodiments further includes an applicator for contacting or administering the pharmaceutical composition to the subject, for example the applicator is at least one selected from the group of: a bottle, a sprayer, a fluid dropper, a solution dropper, an inhaler, a gauze, a strip, a brush, and a syringe.
In various embodiments of the kit, the composition is formulated for delivery to the subject, for example the composition is formulated as an injection; a cream, an ointment; a lotion; an oil; a spray; a powder; a patch; a solution such as an ophthalmic solution, an irrigation solution, or an eye drop solution; or a contact lens.
In a related embodiment of the kit, the composition is formulated sufficiently pure for administration to a subject which is a mammal for example a human, a cow, a dog, a cat, a pig, and a horse.
In a related embodiment of the kit, the composition is formulated for ocular delivery. In a related embodiment, the composition is formulated sterile for delivery in a dose effective to treat the complement activity or the disorder. In various embodiments of the kit, the composition is formulated for delivery that is an injection, for example intra-ocular injection, subconjunctival injection, or subtenon injection.
In a related embodiment of the kit, the composition is formulated wherein the nucleotide sequence is provided in a vector. In a related embodiment, the vector is an engineered viral vector recombinantly linked to the nucleotide sequence encoding the membrane-independent CD59 protein. For example, the vector is at least one selected from an adenovirus, an adeno-associated virus, a herpesvirus, a poxvirus, and a lentivirus. In various embodiments of the kit, the composition is formulated to include a dose of the viral vector particles administered to an affected eye selected from a range of about 107 to about 109; about 108 to about 101°; about 109 to about 10n; about 1011 to about 1012; and about 1011 to about 1013. In a related embodiment, the vector is a synthetic gene delivery vector for delivery of the nucleotide sequence. In a related embodiment, the synthetic gene delivery vector is selected from the group of: a liposome, a lipid/polycation (LPD), a peptide, a nanoparticle, a gold particle, and a polymer. In a related embodiment, the kit and/or composition further comprises a POD composition.
In a related embodiment, the composition further includes a pharmaceutically acceptable salt and a pharmaceutically acceptable emollient. In related embodiments of the kit, the composition is provided or formulated as an eye drop or ointment. In a related embodiment, the composition is of sufficient purity to administer to a mammal. For example the composition is of sufficient purity to administer to a human, a dog, a cat, a horse, a pig, or a cow.
In various embodiments of the kit, the pharmaceutical composition further includes at least one agent selected from the group consisting of: anti-tumor, antiviral, antibacterial, anti-mycobacterial, anti-fungal, anti-proliferative and anti-apoptotic.
In a related embodiment of the kit, the nucleotide sequence encoding the membrane-independent CD59 includes a deletion encoding at least one amino acid sequence in a GPI anchoring domain. For example, the nucleotide sequence includes a deletion of the C-terminal 26 amino acids encoding the signal sequence for attachment of the GPI anchor.
In related embodiments of the kit, the protein and/or the nucleotide sequence encoding the protein includes a deletion of the C-terminal amino acids, for example the deletion is of at least: about one amino acid to four amino acids, about four amino acids to eight amino acids, about eight amino acids to 12 amino acids, about 12 amino acids to about 16 amino acids, about 16 amino acids to about 20 amino acids, or about 20 amino acids to about 24 amino acids.
In a related embodiment of the kit, the protein and/or the nucleotide sequence encoding the membrane-independent protein includes at least one single amino acid alteration resulting in decrease or loss of function of the GPI anchoring domain.
In various embodiments of the kit, the pharmaceutical composition is any pharmaceutical composition described herein. The kit in related embodiments includes the instructions selected from the group of: a method of assaying a serum complement component for prognosis or diagnosis of macular degeneration; a method of making a composition for treating a subject for age-related macular degeneration (AMD) in a subject, and a method of regulating complement activity or treating a complement activity disorder in a subject.
An aspect of the invention provides a pharmaceutical composition comprising: a membrane-independent CD59 protein as shown in SEQ ID NO: 4, or a vector carrying a nucleotide sequence as shown in SEQ NO: 5 that encodes the protein, such that the vector including an adenovirus vector or an adeno-associated virus vector; and a pharmaceutically acceptable buffer, such that the composition is sufficiently pure for administration to a human subject.
Analysis of polymorphisms in several complement regulatory proteins including Factor H have implicated over-active complement in the pathogenesis of AMD (Hageman et al. 2005 Proc Natl Acad Sci USA 102: 7227-7232; Klein et al. 2005 Science 308: 385-389; and Haines et al. 2005 Science 308: 419-421; Edwards et al. 2005 Science 308:421-424). Immunohistochemical analysis of drusen, which are yellow deposits under the retina, and retinal pigment epithelium (RPE) from AMD patients indicated the presence of a variety of complement proteins including the membrane attack complex (MAC). However, cross-species differences between human and non-human complement systems have limited ability to test the efficacy of human complement regulatory proteins in non-human systems in vivo.
Provided herein is a humanized murine model for measuring human MAC deposition in vitro and in vivo. Examples herein use this model to measure protection by human CD59 of murine RPE, the pigmented cell layer just outside the neurosensory retina that nourishes retinal visual cells, from attack by human MAC. Using this model, local expression of exogenously delivered human complement regulatory protein CD59 was found to protect the RPE from human MAC deposition in vivo. Such protection of the RPE by CD59 indicates that this protection can prevent or treat AMD. The humanized model of MAC deposition on murine retina allows for safe and rapid testing of human complement proteins in vivo.
The complement system, a component of the overall immune system of an organism, is a biochemical cascade that assists clearing of pathogens within an organism. The complement system includes a number of small proteins found circulating in blood, usually as inactive zymogens. Stimulated by one of several triggers, proteases in the system cleave specific proteins to release cytokines and initiate an amplifying cascade of further cleavages. Activation of this biochemical cascade results in activation of MAC, a function for killing pathogens.
The complement system is classified into a set of differently activated pathways: the classical complement pathway, the alternative complement pathway, and the mannose-binding lectin pathway. These pathways generate variants of a protease, the C3-convertase. The classical complement pathway typically involves antibodies for activation (specific immune response), while the alternative and mannose-binding lectin pathways are activated by C3 hydrolysis or antigens without the presence of antibodies (non-specific immune response).
In these pathways, a C3-convertase cleaves and activates component C3, creating C3a and C3h and causing a cascade of further cleavage and activation events. One such activation event initiates component C5b. Activation of C5b initiates the membrane attack pathway, which results in formation of MAC, a cytolytic endproduct of the complement cascade that finals a transmembrane channel and causes osmotic lysis of target cells.
MAC is formed for example, on the surface of intruding pathogenic bacterial cells as a result of activation of the complement system. MAC is a complex of four complement system proteins (C5b, C6, C7, and C8) that bind to the outer surface of a plasma membrane of a target cell, and with a fifth protein (C9) that binds subsequently (Sims et al., U.S. Pat. No. 7,166,568 issued Jan. 23, 2007). The complement proteins bind together in such a confirmation that an external face of each protein is hydrophobic and associates with the lipid bilayer of the membrane of the target cell, while an internal face is hydrophilic, allowing passage of water through the cell. The proteins form a ring through the membrane of the cell and the ring structure acts as a tunnel through the membrane, allowing free diffusion of molecules through the cell which disrupts the internal environment of the cell killing it quickly.
Diseases associated with uncontrolled complement activity include: bacterial infection such as with ilaernophilus influenza, Streptococcus pnemoniae, Neisseria meningitidis; angiodema; renal disease for example atypical haemolytic uremic syndrome; paroxysmal nocturnal hemoglobinuria; systemic lupus erythematosus; and central nervous system diseases including Alzheimer's disease and Huntington's disease.
An advantage of the methods, compositions and kits described herein is that a non-membrane binding sCD59 is effective in inhibiting MAC formation under the circumstances of delivery using a CD59-encoding nucleic acid. Examples herein show that membrane targeting of sCD59 is not required to inhibit MAC formation in vivo. Human sCD59 delivered by an approach using methods of gene therapy was observed herein to attenuate CNV in mice using either an adenovirus vector injected subretinally or an AAV vector injected intravitreally. The sCD59 delivered by a vector was observed to reduce the extent of MAC deposition on laser-induced CNV spots.
The eye provides an ideal environment for using sCD59. Examples herein show that sCD59 comprising no or a functionally ineffective membrane targeting moiety significantly attenuated MAC formation and reduced CNV in vivo. sCD59 delivered using vectors having a nucleotide sequence encoding the protein is therefore useful as a therapeutic for both the wet as well as dry forms of AMD.
Delivery of vectors carrying nucleotide sequences encoding soluble CD59 protein provides more effective expression than a GPI-anchored human CD59 expressed on murine RPE in vivo. GPI-anchored CD59 protected those cells from human complement mediated attack ex vivo, however data show that only those cells that synthesized and expressed the CD59 molecule on their surface were protected from complement-mediated damage. Methods using membrane-bound CD59 did not inhibit choroidal neovascularization, or even target of blood vessels, a tissue intimately implicated in wet AMD. Without being limited by any particular theory or mechanism of action, it is here envisioned that contacting cells with sCD59 produced a subset of cells that are ‘factories’ for local production and secretion of a soluble CD59, which protected a large number of adjacent ocular cells including the RPE and choroidal blood vessels.
Human sCD59 delivered for example using vectors and methods such as using an adenovirus vector injected subretinally or an AAV vector injected intravitreally attenuated CNV in murine subjects. Compositions, methods and kit described herein used sCD59 to reduce the extent of MAC deposition on laser-induced CNV spots. Examples herein show that sCD59 is useful for treating wet as well and dry forms of AIVID and other ocular diseases associated with complement activity.
Compositions, methods and kits using nucleotide sequences encoding sCD59 offer additional advantages over protein-based delivery methods. Peptides and antibodies have limited half-lives in vivo and need to be re-administered on a regular basis. Current treatments for wet AMD patients include for example intraocular ranibizumab antibody injections every four to six weeks. This method of treatment exposes patients to complications associated pathologies such as endophthalmitis. The incidence of endophthalmitis is relatively low (0.16% per dose) in the presence of a robust immune system, however the rate increases substantially due to the cumulative effect of an attenuated complement system and serial injections over many years such as for treating chronic diseases such as AMD. Hence, frequent injection of complement inhibitors into AMD eyes is not desirable or effective. Compositions, methods and kits described herein using sCD59 limit the frequency of injection administration and therefore provide a more safe and effective treatment for subjects having complement disorders such as ocular pathologies.
Viral vectors such as adenovirus have been used to provide lifetime expression of transgenes in vivo in mice. AAV vectors for example have facilitated transgene expression in dogs for more than seven years. In humans, AAV has been found to have therapeutic transgene expression for over 3.7 years, the longest time periods studied. Adenovirus has been found to be an efficient vector for delivery of transgenes to ocular tissue and has been found to be safe in several ocular gene therapy trials. Adenovirus vectors engineered for long-term transgene expression and the technology for scaled production of such vectors are well known. AAV vectors have been shown to be safe for use in humans and are generally considered less immunogenic than adenovirus vectors. Examples herein show using AAV vectors to produce and deliver sCD59 in vivo. sCD59 delivered to AMD eyes using an AAV vector therefore is effective for long-term transgene expression. sCD59 is known to occur naturally endogenously in ocular tissues (at levels lower than that following recombinant transgene expression described herein). Therefore an immune response against sCD59 is not likely to be observed.
Examples herein show a pharmaceutical composition for treating macular degeneration including a vector carrying a nucleotide sequence encoding a recombinantly engineered human CD59 protein operably linked to a promoter sequence causing expression of the protein in a cell, such that the nucleotide sequence carries at least one mutation conferring loss of a glycosyl phosphatidyl inositol (GPI) anchoring function, such that the protein is expressed as a recombinant membrane-independent CD59 (rmiCD59) protein and is not membrane targeting, the composition further comprising a pharmaceutically acceptable buffer. In various embodiments, the macular degeneration is wet, or the macular degeneration is dry.
In a related embodiment, the pharmaceutical composition is formulated sterile for ocular delivery, in a dose effective to treat macular degeneration.
In related embodiments, the vector is at least one of: an engineered viral vector recombinantly linked to the nucleotide sequence encoding the rmiCD59 protein; and a synthetic gene delivery vector for delivery of the nucleotide sequence. For example, the viral vector is selected from: adenovirus, adeno-associated virus, a herpesvirus, a poxvirus, and a lentivirus; and the synthetic gene delivery vector is selected from a liposome, a lipid/polycation (LPD), a peptide, a nanoparticle, a gold particle, and a polymer.
In a related embodiment, the pharmaceutical composition further includes a peptide for overall delivery, POD, composition operably linked to the compound to obtain a conjugated compound, such that the POD includes a protein transduction domain (PTD). For example the POD composition is one shown in Kumar-Singh et al. PCT/US2008/010179 filed Aug. 28, 2008 or Kumar-Singh et al. U.S. publication 2010/0209447 published Aug. 19, 2010, each of which is incorporated herein by reference in its entirety.
In related embodiments, the composition formulated for ocular delivery further includes at least one of a pharmaceutically acceptable buffer, a pharmaceutically acceptable salt and a pharmaceutically acceptable emollient suitable for delivery by at least one route selected from: intra-ocular injection, subconjunctival injection, subtenon injection, eye drop, and ointment.
Related embodiments of the above pharmaceutical compositions include the dose of the viral vector particles administered to an affected eye selected from a range of about 107 to about 109; about 108 to about 1010; about 109 to about 1011; about 1011 to about 1012; and about 1011 to about 1013. In related embodiments, the pharmaceutical composition further includes at least one agent selected from the group consisting of: anti-tumor, antiviral, antibacterial, anti-mycobacterial, anti-fungal, anti-proliferative and anti-apoptotic.
In a related embodiment of the pharmaceutical composition, the promoter sequence is a ubiquitous promoter for general for expression in a mammalian cell for example a promoter from a gene encoding actin, polyhedron, and hydroxyl-methylglutaryl CoA reductase (H1VIGCR). For example, the promoter is a chicken beta-actin promoter or a human beta-actin promoter. Alternatively, the promoter sequence is a tissue specific promoter for expression in a specific cell-type for example rhodopsin promoter or tissue specific promoter for the eye or liver.
In a related embodiment, the nucleotide sequence encoding the infiCD59 includes a deletion of the GPI anchoring domain. In a related embodiment, the nucleotide sequence encoding the nniCD59 comprises at least one single amino acid alteration resulting in decrease or loss of function of the GPI anchoring domain. For example the CD59 is engineered to include a modified C-terminal GPI signal anchor sequence at an amino acid position affecting attachment of the GPI anchor, so that the mutation renders the anchor non-functional. For example the CD59 is engineered to delete the C-terminal GPI signal anchor sequence at an amino acid position affecting attachment of the GPI anchor, so that the mutation inhibits attachment of the anchor.
A method is also provided for formulating a composition for treating age-related macular degeneration (AMD) in a subject, including: engineering a vector to deliver and express a CD59 nucleotide sequence encoding an amino acid sequence corresponding to human CD59, such that the nucleotide sequence includes a mutation encoding for amino acids of a glycosyl phosphatidyl inositol (GPI) anchoring domain of the protein, such that the resulting vector encodes an engineered recombinant membrane-independent CD59 (rmiCD59) protein, and the vector is a viral vector or a synthetic gene delivery vector; and, contacting at least one ocular tissue of the subject with the composition, such that the cells of the tissue express and secrete the CD59 locally, thereby treating the subject for AMD.
In a related embodiment of the method, the viral vector is derived from a genetically engineered genome of at least one virus selected from: an adenovirus, an adeno-associated virus, a herpesvirus, and a lentivirus, and the synthetic gene delivery vector is selected from a liposome, a lipid/polycation (LPD), a peptide, a nanoparticle, a gold particle, and a polymer.
In a related embodiment, contacting further includes injecting by a route selected from subretinal; subconjunctival; subtenon; subcutaneous; intravenous; and intravitreal. In related embodiments of the method, the tissues contacted by the composition include at least one selected from: retinal pigment epithelium, retina, choroid, sclera, Bruch's membrane, and choroidal blood vessels.
Examples also provide a method of regulating complement activity or treating a complement activity disorder in a subject, the method including: contacting an affected tissue or organ of the subject at risk for or suffering from the complement activity disorder with a composition including a vector carrying a nucleotide sequence encoding a recombinantly engineered human CD59 protein operably linked to a promoter sequence causing expression of the protein in a cell, such that the protein includes at least one mutation resulting in loss of function of glycosyl phosphatidyl inositol (GPI) anchoring domain, such that the protein is recombinant membrane-independent CD59 (intiCD59) and is not membrane targeting; and, observing a physiological indicium of the complement activity disorder after contacting, in comparison to an abnormal amount of the physiological indicium observed prior to contacting, such that a decrease after contacting compared to prior to contacting is a positive indication that the affected tissue or organ is treated.
In related embodiments of the method, the affected tissue is selected from epithelial tissue, endothelial tissue, and vascular tissue. In related embodiments, the affected organ is selected from eye, heart, kidney, lung, liver, pancreas, and vascular system. In related embodiments, the subject is a tissue or organ donor or recipient. For example, the subject is a immunocompromised patient that is an organ recipient.
In related embodiments of the method, the disorder is selected from: macular degeneration, bacterial infection, toxic shock syndrome (TSS), atypical hemolytic uremic syndrome, membranoproliferative glomerulonephritis, dense deposit disease, peroximal nocturnal hemoglobinurea, systemic lupus erythromatosis, and atherosclerosis and the like. For example, the disorder is macular degeneration, and observing further includes measuring the indication selected from: visual acuity; visual aberrations; and amount of MAC deposition. For example, the disorder is bacterial infection or TSS, and observing further includes measuring the indication selected from: bacterial titer in a tissue or bodily fluid, extent of fever, and extent of inflammation. For example, the disorder is membranoproliferative glomerulonephritis, and observing further includes measuring the indication selected from: serum complement; urine protein; urine nitrogen; urine creatinine; glomerular filtration rate; effective renal blood flow; filtration fraction; and glomerular sieving. For example, the disorder is atherosclerosis, and observing further includes measuring the indication selected from at least one of: serum low density cholesterol; serum total cholesterol; angioscopy; and quantitative colorimetric angioscopy.
In addition the examples include a method of assaying a serum complement component for prognosis or diagnosis of macular degeneration (MD), the method including: contacting a first sample of cells to a sample of the serum and measuring resulting lysis, and comparing extent of lysis to that in a second sample of control cells not so exposed to the serum and otherwise identical, such that the serum added to the first sample of cells is obtained from a patient in need of diagnosis for MD and an optional control serum is obtained from a normal subject and added to an optional third sample of cells, such that a greater extent of lysis in the first sample compared to that in the second sample and the optional third sample is an indication of prognosis or diagnosis of MD.
In a related embodiment, the method further includes contacting at least a fourth sample of cells to a candidate therapeutic composition and otherwise identically to the serum and measuring lysis, such that the extent of lysis of the third sample compared to that in the first sample and the second sample is a measure of protection by the candidate composition, thereby assaying for a potential therapeutic agent for efficacy in treatment of macular degeneration. In a related embodiment, the method further includes prior to contacting with serum, contacting the cells with a recombinant vector encoding a gene capable of expressing a human recombinant membrane-independent CD59 (mriCD59) protein, such that the mriCD59 protein lacks a glycosyl phosphatidyl inositol anchoring domain, and such that a decrease in cell lysis in the presence of mriCD59 compared to absence of mriCD59 is an indicium of suitability of the patient for treatment of macular degeneration with mriCD59.
CD59 Protein
Data in Examples herein show that membrane-independent CD59 protein, for example soluble CD59 protein, inhibited MAC, preventing lysis of retina cells. CD59 is a membrane-bound glycoprotein found associated with membranes of cells including human erythrocytes, lymphocytes, and vascular endothelial cells. CD59 protein inhibits assembly of functional MACs and thus protects cells from complement-mediated activation and/or lysis.
Without being limited by any particular theory or mechanism of action, it is here envisioned that plasma membranes of cells are normally protected from the effects of complement by cell-surface proteins, e.g., CD59, that specifically inhibit activation of the C5b-9 pore upon C9 complement protein binding to membrane C5b-8 (Holguin et al. 1989 J. Clin. Invest. 84: 7-17; Sims et al. 1989 J. Biol. Chem. 264: 19228-19235; Davies et al. 1989 J. Exp. Med. 170: 637-654; Rollins et al. 1990 J. Immunol. 144: 3478-3483; and Hamilton et al. 1990 Blood 76: 2572-2577). CD59 competes with C9 complement protein for binding to C8 complement protein in the C5b-8 complex, thereby decreasing or preventing the formation of the C5b-9 membrane attack complex. CD59 thus acts to reduce both cell activation and cell lysis by terminal complement MACs.
Mature human CD59 protein is composed of 77 amino acids and has a molecular weight of 18-21 kD. Precursor human CD59 protein includes an amino-terminal signal peptide of 25 amino acids and a carboxyl-terminal peptide of 26 amino acids which results in attachment of a membrane anchor. Amino acid sequences of examples of precursor human CD59, a mature human CD59, and CD59 sequences of other mammals, e.g., baboon, African green monkey, owl monkey, marmoset, HVS-15, pig, rabbit, rat, and mouse, are shown in Sims et al. U.S. Pat. No. 7,166,568 issued Jan. 23, 2007.
Protein structure of CD59 includes a single cysteine-rich domain, a hydrophobic core with three loops and a small fourth helical loop (Yu et al. 1997 Journal of Experimental Medicine 185(4): 745-753).
The structure and sequence of the gene encoding CD59 has been characterized (Fodor et al. U.S. Pat. No. 5,624,837 issued Apr. 29, 1997). The gene is located on the short arm of chromosome 11 in humans, specifically chromosome 11p13 and 11p14 (Online Mendelian Inheritance in Man accession number and 107271), and consists of 4 exons spanning 20 kb (Petranka et al. 1992 Proc. Nat. Acad. Sci. 89: 7876-7879). An untranslated first exon is preceded by a G and C-rich promoter region that lacks a consensus TATA or CAAT motif. The second exon encodes the hydrophobic leader sequence of the protein, and the third exon encodes the N-terminal portion of the mature protein. The fourth exon encodes the remainder of the mature protein, including the hydrophobic sequence for glycophosphoinosital anchor attachment to a cell membrane.
CD59 is a glycosylphosphatidylinositol-anchored glycoprotein that is expressed on human peripheral blood leukocytes, erythrocytes, and many cell lines. The protein is expressed on both hematopoietic and non-hematopoietic non-hemopoietic cells, for example on endothelial cells, peripheral nerve fibers, neurons, microglia, oligodendrocytes, astrocytes, ependymal cells, epithelial cells, acinar cells of the salivary glands, bronchial epithelium, renal tubules and squamous epithelium. See Nose, M. et al. 1990 Immunology 70(2): 145-149; Vedeler, C. et al. 1994 Immunology 82(4): 542-547; and Hidestima, T. et al. 1990 Immunology 69(3): 396:401, each of which is incorporated herein by reference in its entirety. A cDNA encoding CD59 was reported by Sawada, R. et al. 1989 Nucleic Acids Res 17(16): 6728. CDNA encoding CD59 has also been cloned from human T-cell leukemia (YT) and human erythroleukemia (K562) cell lines, and CD59 has been transiently expressed in COS cells (Walsh, L. A. et al. 1990 Eur J. Immo]. 21(3): 847-850). Human CD59 includes 26 amino acids located at the C terminus, which specifies a signal sequence for attachment of a glycosyl phosphatidyl inositol anchor (GPI anchor) at amino acid asparagine at position 77. A eDNA sequence of CD59 is shown in Fodor et al., U.S. Pat. No. 5,624,837 issued Apr. 29, 1997, which is incorporated herein by reference in its entirety.
Analysis of the physical association of CD59 with components of MAC shows that separate binding sites for CD59 are contained within the a-chains of each of human C8 and human C9. The binding site for interactions of human CD59 with human C9 has been identified as amino acid residues 42 to 58 in the sequence of mature human CD59, that bind to the region of human C9 corresponding to human amino acid residues 334 to 418 of that protein, more particularly human C9 amino acid residues 359 to 384, immediately C-terminal to the predicted membrane-inserting domain of C9 (Sims et al. PCT/US96/17940 filed Nov. 8, 1996 which is incorporated herein by reference in its entirety).
The active surface exposed amino acid residue side chains that are available to bind C8/C9, identified from solution structure of mature human CD59 from published NMR data and the knowledge of the active portion of the CD59 molecule, are histidine at position 44, asparagine at position 48, aspartic acid at position 49, threonine at positions 51 and 52, arginine at position 55, and glutamic acid at position 58. NMR structures for CD59 are described in deposits by Kieffer et al., Human Complement Regulatory Protein CD59 (Extracellular Region, Residues 1 70; NMR, 10 Structures), MMDB Id: 891, PDB Id: 1ERH; Kieffer et al., Human Complement Regulatory Protein CD59 (Extracellular Region, Residues 1 70; NMR, Restrained), MMDB Id: 890, PDB Id: 1ERG; Fletcher et al., CD59 Complexed With Glenac-Beta-1,4-(Fue-Alpha-1,6)-Glcnac-Beta-1 (NMR, 10 Structures), MMDB Id: 498, PDB Id: 1CDS; Fletcher et al., CD59 Complexed With Glcnac-Beta-1,4-Glcnac-Beta-1 (NMR, 10 Structures), MMDB Id:497, PDB Id: 1CDR. The 1CDS and 1CDR deposits by Fletcher et al. Amino acid sequences of CD59 that present these side chains at the same relative positions function in a manner similar to human CD59 (Sims et al.), and such variants are within the scope of the methods, kits and pharmaceutical compositions herein.
The relationship between complement activation and abnormal levels of autoantibodies has been analyzed with respect to ocular diseases such as macular degeneration and other conditions. Hageman et al. U.S. patent application number 2005/0287601 published Dec. 29, 2005 proposes diagnosing macular degeneration by measuring presence of autoantibodies specific for a retinal protein (RPE and choroid proteins) in samples from AMD patients.
Theories have connected causation of Alzheimer's disease and age-related macular degeneration by complement, and prevention inhibiting activation of the complement system and formation of MAC. Dinu U.S. patent application number 2007/0196367 A1 published Aug. 23, 2007 proposes preventing debris formation by inhibiting complement as a therapeutic for Alzheimer's disease and AMD. Patil et al. U.S. patent application number 2007/0203190 A1 published Aug. 30, 2007 lists hydroxylamine compounds (e.g., TEMPOL-H, TEMPO-H, and OXANO-H) or ester derivatives as putative inhibitors of complement activation.
Tomlinson et al., U.S. patent application number 2005/0265995 published Dec. 1, 2005 inhibits complement-directed proteinuria in rats using an agent produced by linking each of complement inhibitors Crry and CD59 at the amino-terminus to single-chain antibody (scFv) that binds to rat glomerular epithelial cells and proximal tubular epithelial cells. Soluble CD59 is described in this reference as ineffective as an inhibitor. Bora et al. 2007 J. Immunol 178: 1783-1790 uses recombinant methods to produce a membrane targeting composition by fusing the binding arm, Fe, of an immunoglobulin G (IgG1) to CD59 protein (rsCD59a-Fc), and injects this fusion into mice by intravenous, intra-ocular (intravitreal) and intra-peritoneal routes. Numbers of CNV-positive spots were reduced in subjects treated with the fusion protein by the intraperitoneal route compared to intravitreal and intravenous routes. The Fc functionality may result in immediate binding upon contact of the fusion protein generally and non-specifically to cells following administration. Administering purified protein is further limited by metabolism and half-life due to presence of proteases and peptidases. Tomlinson et al. 2009 IOVS 50(7): 3056-3064 reduced the size of CNV spots in a mouse model by intravenously injecting the animals having CNV spots with a plasmid encoding a fusion protein complement inhibitor, produced by linking the N-terminus binding domain of factor H to a fragment of complement receptor 2 (CR2) that targets membrane molecules on cells.
A CD59 composition used herein lacks the primary amino acid sequence for a functional GPI anchor. A functional equivalent protein includes a modified GPI anchor domain amino acid sequence that is functionally defective and lacks the ability to target a membrane. A sCD59 is an example of a recombinant membrane-independent CD59 (iiiiiCD59). Additional methods of obtaining membrane-independent CD59 include non-recombinant methods such as providing an inhibitor of membrane association, for example, synthesizing CD59 in vivo or in vitro such that the GPI anchor is lacking. Methods of obtaining the membrane-independent CD59 are shown in examples herein. Additional recombinant techniques for altering the nucleic acid sequence and amino acid sequence of a molecule are well known in the art of genetics and molecular biology.
In various embodiments, the composition includes a CD59 protein that includes a full length nucleic acid of CD59 that was modified to remove the signal sequence for attachment of the GPI anchor at the nucleotides encoding amino acid asparagine at position 77. Alternatively the nucleic acid sequence of CD59 is modified by point mutations, substitutions or deletions to obtain a nucleic acid sequence that encodes an amino acid sequence that has a modified amino acid sequence at the GPI anchor location, such that the protein is unable to attach to a membrane of a cell.
The term “membrane independent” as used herein refers to a CD59 amino acid sequence that lacks a GPI anchor or has a modified GPI anchor that lacks function and ability to bind to a cell membrane or a cell-membrane-associated structure such as a membrane-bound protein.
GPI anchoring involves a multi-step pathway in the endoplasmic reticulum including the interaction of numerous gene products. Many proteins including CD59 require GPI to be expressed at the cell surface and to function effectively. The mechanism by which structure in a protein signal encodes for attachment of GPI anchors is reviewed by Orlean et al. 2007 JLR 48: 993-1011. GPI attachment generally involves an amino acid sequence that contains: a hydrophobic N-terminal secretion signal that targets the protein to the ER, and a C-terminal GPI signal anchor sequence. In addition to the native CD59 secretion signal which is located at the amino teiniinus of the protein and is cleaved in vivo, other secretion signals are suitable for CD59 protein and are within the scope of the methods herein. General eukaryotic secretion signals that are suitable for use in mammalian cells here are described for example in Ding et al. U.S. Pat. No. 6,733,997 B1 issued May 11, 2004; Tan et al. 2002 Protein Engineering 15(4): 337-345; and Tan et al. 1999 Biochim. Biophys. Acta 1452: 103-120, each of which is incorporated herein by reference in its entirety.
The amino acid to which the GPI becomes linked is referred to as the omega (ω) residue, with amino acids N-terminal to the omega residue referred to as omega-minus (ω−) and with amino acids C-terminal to the omega residue referred to as omega-plus (ω+). The GPI anchor sequence includes a stretch of about ten polar amino acids (i.e., ω-10 to ω-1), for example arginine, lysine, aspartate, glutamate, asparagine, or glutamate, that form a flexible linker region. The co residue has been observed to be one of: glycine, alanine, serine, asparagine, aspartic acid, or cysteine. Mutation including substitution and deletion of nucleic acids encoding amino acids at omega positions are used to reduce or eliminate the attachment of the GPI anchor or reduce or eliminate the effective functionality of the GPI anchor. For example, such a variation includes substituting the nucleic acids encoding hydrophobic leucine (e.g., nucleic acids CTG) and alaninc (e.g., nucleic acids GCA) with nucleic acids encoding glycine (e.g., nucleic acids CAG) and glutamate (e.g., nucleic acids GAA), which are less hydrophobic (i.e., more hydrophilic) amino acids. Alternatively, a variation includes substituting the co residue with another amino acid, for example substituting a glycine for a tyrosine.
Other promoter sequences that regulate transcription of CD59 gene sequences are within the scope of expression of the vectors herein. These promoters are for example constitutive promoters, cell cycle-specific promoters, ubiquitous promoters, tissue-specific promoters, metabolically regulated promoters, inducible promoters, and promoters that are found in specific subjects including humans and animals. Examples of promoters and promoter systems are shown for example in Evans et al. U.S. Pat. No. 6,677,311 131 issued Jan. 13, 2004; Clark et al. U.S. Pat. No. 7,109,029 B2 issued Sep. 19, 2006; and Hallenbeck et al. U.S. Pat. No. 5,998,205 issued Dec. 7, 1999, each of which is incorporated herein by reference in its entirety.
In the remainder of the protein not involved in GPI anchoring, the scope of the CD59 protein herein is envisioned to include conservative sequence modifications. As used herein, the term “conservative sequence modifications” refers to amino acid modifications that do not significantly affect or alter the characteristics of the CD59 protein or membrane-independent CD59 containing the amino acid sequence, i.e., amino acid sequences of CD59 that present these side chains at the same relative positions will function in a manner similar to human CD59. Such conservative modifications include amino acid substitutions, additions and deletions. Modification of the amino acid sequence of CD59 is achieved using any known technique in the art e.g., site-directed mutagenesis or PCR based mutagenesis. Such techniques are described in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Plainview, N.Y., 1989 and Ausubel et al., Current Protocols in Molecular Biology, John Wiley & Sons, New York, N.Y., 1989.
Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
In certain embodiments, the CD59 amino acid sequence is an amino acid sequence that is substantially identical to that of the wild type sequence. The term “substantially identical” is used herein to refer to a first amino acid sequence that contains a sufficient or minimum number of amino acid residues that are identical to aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and/or common functional activity. For example, amino acid sequences that contain a common structural domain having at least about 60% identity, or at least 75%, 80%, 85%, 90%, 95%, 96%, 98%, or 99% identity.
Calculations of sequence identity between sequences are performed as follows. To determine the percent identity of two amino acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid sequence for optimal alignment). The amino acid residues at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the proteins are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
The comparison of sequences and determination of percent identity between two sequences are accomplished using a mathematical algorithm. Percent identity between two amino acid sequences is deteiinined using an alignment software program using the default parameters. Suitable programs include, for example, CLIJSTAL W by Thompson et al., Nuc. Acids Research 22:4673, 1994 (www.ebi.ac.uk/clustalw), BL2SEQ by Tatusova and Madden, FEMS Microbiol. Lett. 174:247, 1999 (www.ncbi.nlm nih.gov/blast/b12seq/b12.htm1), SAGA by Notredame and Higgins, Nuc. Acids Research 24: 1515, 1996 (igs-server.enrs-mrs.fil/˜enotred), and DIALIGN by Morgenstern et al., Bioinformatics 14: 290, 1998 (bibiserv.techfak.uni-bielefeld.de/dialign).
Vectors
In various embodiments of the invention herein, a method for treating a complement disorder (e.g., AMD) is provided, the method including contacting cells or tissue with a pharmaceutical composition including a source of membrane independent CD59 protein or as a source of CD59 expression in vivo. For example, the CD59 protein is administered as a recombinantly produced protein. The term “recombinant” refers to proteins produced by manipulation of genetically modified organisms, for example micro-organisms.
In accordance with the present invention a source of CD59 includes polynucleotide sequences that encode the CD59 protein, for example, engineered into recombinant DNA molecules to direct expression of the CD59 protein in appropriate host cells. To express a biologically active CD59 protein, a nucleotide sequence encoding the CD59 protein, or functional equivalent, is inserted into an appropriate expression vector, i.e., a vector that contains the necessary nucleic acid encoding elements that regulate transcription and translation of the inserted coding sequence, operably linked to the nucleotide sequence encoding the CD59 protein amino acid sequence.
Methods that are well known to those skilled in the art are used to construct expression vectors containing a sequence encoding the CD59 protein operably linked to appropriate transcriptional and translational control elements. These methods include in vitro recombinant DNA techniques, synthetic techniques and in vivo recombination or genetic recombination. Such techniques are described in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Plainview, N.Y., 1989.
A variety of commercially available expression vector/host systems are useful to contain and express a CD59 protein encoding sequence. These include hut are not limited to microorganisms such as bacteria transformed with recombinant baeteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems contacted with virus expression vectors (e.g., baculovirus); plant cell systems transfected with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with bacterial expression vectors (e.g., Ti, pBR322, or pET25b plasmid); or animal cell systems. See Ausubel et al., Current Protocols in Molecular Biology, John Wiley & Sons, New York, N.Y., 1989.
Virus vectors include, but are not limited to, adenovirus vectors, lentivirus vectors, adeno-associated virus (AAV) vectors, and helper-dependent adenovirus vectors. Virus vectors deliver a nucleic acid sequence that encodes CD59 protein that as shown herein interferes with the deleterious action of the MAC in pathogenesis of AMD. Adenovirus packaging vectors are commercially available from American Type Tissue Culture Collection (Manassas, Va.). Methods of constructing adenovirus vectors and using adenovirus vectors are shown in Klein et al. 2007 Ophthalmology 114: 253-262, and van Leeuwen et al. 2003 Eur. J. Epidemiol. 18: 845854.
Adenovirus vectors have been used in eukaryotic gene expression (Levrero et al. 1991 Gene, 101: 195-202) and vaccine development (Graham et al. 1991 Methods in Molecular Biology: Gene Transfer and Expression Protocols 7, (Murray, Ed:), Humana Press, Clifton, N.J., 109-128). Further, recombinant adenovirus vectors are used for gene therapy (Wu et al. U.S. Pat. No. 7,235,391 issued Jun. 26, 2007 which is incorporated herein by reference in its entirety).
Recombinant adenovirus vectors are generated, for example, from homologous recombination between a shuttle vector and a provirus vector (Wu et al., U.S. Pat. No. 7,235,391 issued Jun. 26, 2007). The adenovirus vectors herein are replication defective, for example, are conditionally defective, lacking adenovirus El region, and a polynucleotide encoding CD59 is introduced at the position from which the El-coding sequences have been removed. The polynucleotide encoding the CD59 gene alternatively is inserted in the E3 region.
Helper cell lines may be derived from human cells such as, 293 human embryonic kidney cells, muscle cells, hematopoietic cells or other human embryonic mesenchymal or epithelial cells. Alternatively, the helper cells may be derived from the cells of other mammalian species that are permissive for human adenovirus, e.g., Vero cells or other monkey embryonic mesenchymal or epithelial cells. Generation and propagation of these replication defective adenovirus vectors using a helper cell line is described in Graham et al 1977 J. Gen. Virol. 36: 59-72.
Lentiviral vector packaging vectors are commercially available from Invitrogen Corporation (Carlsbad Calif.). An HIV-based packaging system for the production of lentiviral vectors is prepared using constructs in Naldini et al. 1996 Science 272: 263-267; Zufferey et al. 1997 Nature Biotechnol. 15: 871-875; and Dull et al. 1998 J. Virol. 72: 8463-8471.
A number of vector constructs are available to be packaged using a system, based on third-generation lentiviral SIN vector backbone (Dull et al. 1998 J. Virol. 72: 8463-8471). For example the vector construct pRRLsinCMVGFPpre contains a 5′ LTR in which the HIV promoter sequence has been replaced with that of Rous sarcoma virus (RSV), a self-inactivating 3′ LTR containing a deletion in the U3 promoter region, the HIV packaging signal, RRE sequences linked to a marker gene cassette consisting of the Aequora jellyfish green fluorescent protein (GFP) driven by the CMV promoter, and the woodchuck hepatitis virus PRE element, which appears to enhance nuclear export. The GFP marker gene allows quantitation of transfection or transduction efficiency by direct observation of UV fluorescence microscopy or flow cytometry (Kafri et al. 1997 Nature Genet. 17: 314-317; and Sakoda et al. 1999 J. Mol. Cell. Cardiol. 31: 2037-2047).
Manipulation of retroviral nucleic acids to construct a retroviral vector containing the gene that encodes for CD59 protein and packaging cells is accomplished using techniques known in the art. See Ausubel, et al., 1992, Volume 1, Section III (units 9.10.1-9.14.3); Sambrook, et al., 1989. Molecular Cloning: A Laboratory Manual. Second Edition. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Miller, et al., Biotechniques. 7:981-990, 1989; Eglitis, et al., Biotechniques. 6:608-614, 1988; U.S. Pat. Nos. 4,650,764, 4,861,719, 4,980,289, 5,122,767, and 5,124,263; and PCT patent publications numbers WO 85/05629, WO 89/07150, WO 90/02797, WO 90/02806, WO 90/13641, WO 92/05266, WO 92/07943, WO 92/14829, and WO 93/14188, each of which is incorporated by reference in its entirety.
A retroviral vector is constructed and packaged into non-infectious transducing viral particles (virions) using an amphotropic packaging system. Examples of such packaging systems are found in, for example, Miller et al. 1986 Mol. Cell Biol. 6:2895-2902; Markowitz et al. 1988 J. Virol. 62:1120-1124; Cosset et al. 1990 J. Virol. 64: 1070-1078; U.S. Pat. Nos. 4,650,764, 4,861,719, 4,980,289, 5,122,767, and 5,124,263, and PCT patent publications numbers WO 85/05629, WO 89/07150, WO 90/02797, WO 90/02806, WO 90/13641, WO 92/05266, WO 92/07943, WO 92/14829, and WO 93/14188, each of which is incorporated by reference in its entirety.
Generation of “producer cells” is accomplished by introducing retroviral vectors into the packaging cells. Examples of such retroviral vectors are found in, for example, Korman et al. 1987 Proc. Natl. Acad. Sci. USA. 84: 2150-2154; Morgenstern et al. 1990 Nucleic Acids Res. 18: 3587-3596; U.S. Pat. Nos. 4,405,712, 4,980,289, and 5,112,767; and PCT patent publications numbers WO 85/05629, WO 90/02797, and WO 92/07943.
Herpesvirus packaging vectors are commercially available from Invitrogen Corporation, (Carlsbad, Calif.). Exemplary herpesviruses are an a-herpesvirus, such as Varicella-Zoster virus or pseudorabi es virus; a herpes simplex virus such as HSV-1 or HSV-2; or a herpesvirus such as Epstein-Barr virus. A method for preparing empty herpesvirus particles that can be packaged with a desired nucleotide segment, for example a CD59 nucleotide or polynucleotide sequence, in the absence of a helper virus that is capable to most herpesviruses is shown in Fraefel et al. (U.S. Pat. No. 5,998,208, issued Dec. 7, 1999 which is incorporated by reference in its entirety).
The herpesvirus DNA vector can be constructed using techniques familiar to the skilled artisan. For example, DNA segments encoding the entire genome of a herpesvirus is divided among a number of vectors capable of carrying large DNA segments, e.g., cosmids (Evans, et al., Gene 79, 9-20, 1989), yeast artificial chromosomes (YACS) (Sambrook, J. et al., MOLECULAR CLONING: A LABORATORY MANUAL, 2nd Edition, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 1989) or E. coli F element plasmids (O'Conner et al. 1989 Science 244:1307-1313).
For example, sets of cosmids have been isolated which contain overlapping clones that represent the entire genomes of a variety of herpesviruses including Epstein-Barr virus, Varicella-Zoster virus, pseudorabies virus and HSV-1. See M. van Zijl et al. 1988 J. Virol. 62: 2191; Cohen et al. 1993 Proc. Nat'l Acad. Sci. U.S.A. 90: 7376; Tomkinson et al. 1993 J. Virol. 67: 7298; and Cunningham et al. 1993 Virology 197: 116.
AAV is a dependent parvovirus in that it depends on co-infection with another virus (either adenovirus or a member of the herpes virus family) to undergo a productive infection in cultured cells (Muzyczka 1992 Curr Top Microbiol Immunol, 158: 97 129). For example, recombinant AAV (rAAV) virus is made by co-transfecting a plasmid containing the gene of interest, for example, the CD59 gene, flanked by the two AAV terminal repeats (McLaughlin et al. 1988 J. Virol., 62(6): 1963-1973; Samulski et al. 1989 J. Virol, 63: 3822-3828) and an expression plasmid containing the wild-type AAV coding sequences without the terminal repeats. Cells are also contacted or transfected with adenovirus or plasmids carrying the adenovirus genes required for AAV helper function. Recombinant AAV virus stocks made in such fashion include with adenovirus which must be physically separated from the recombinant AAV particles (for example, by cesium chloride density centrifugation).
Adeno-associated virus (AAV) packaging vectors are commercially available from GeneDetect (Auckland, New Zealand). AAV has been shown to have a high frequency of integration and infects nondividing cells, thus making it useful for delivery of genes into mammalian cells in tissue culture (Muzyczka 1992 Curr Top Microbiol Immunol 158: 97-129). AAV has a broad host range for infectivity (Tratschin et al. 1984 Mol. Cell. Biol. 4: 2072-2081; Laughlin et al. 1986 J. Virol., 60(2): 515-524; Lebkowski et al. 1988 Mol. Cell. Biol. 8(10): 3988-3996; McLaughlin et al. 1988 J. Virol. 62(6):1963-1973).
Methods of constructing AAV vectors and using AAV vectors are described, for example in U.S. Pat. No. 5,139,941 (Wu et al.) issued Jun. 26, 2007 and U.S. Pat. No. 4,797,368 (Carter et al.) issued Jan. 10, 1989. Use of AAV in gene delivery is further described in LaFace et al. 1988 Virology 162(2): 483 486; Zhou et al. 1993 Exp. Hematol, 21: 928-933; Flotte et al. 1992 Am. J. Respir. Cell Mol. Biol. 7(3): 349-356; and Walsh et al. 1994 J. Clin. Invest 94: 1440-1448.
Recombinant AAV vectors have been used successfully for in vitro and in vivo transduction of marker genes (Kaplitt et al. 1994 Nat Genet., 8(2):148-154; Lebkowski et al. 1988 Mol. Cell. Biol. 8(10): 3988-3996; Samulski et al. 1991 EMBO J. 10: 3941-3950; Shelling and Smith 1994 Gene Therapy, 1: 165-169; Yoder et al. 1994 Blood, 82 (Supp.): 1: 347A; Zhou et al. 1993 Exp. Hematol 21: 928-933; Tratschin et al. 1985 Mol. Cell. Biol. 5: 3258-3260; McLaughlin et al. 1988 J. Virol. 62(6): 1963-1973) and transduction of genes involved in human diseases (Flotte et al. 1992 Am. J. Respir. Cell Mol. Biol. 7(3): 349-356; Ohi et al. 1990 Gene, 89(2): 279-282; Walsh et al. 1994 J. Clin. Invest. 94: 1440-1448; and Wei et al. 1994 Gene Therapy, 1: 261 268).
In certain embodiments, the vectors herein are non-viral vectors for example synthetic gene delivery vehicles or vectors that are not related to a virus particle and that specifically deliver the gene material to the target cells or tissue. Examples of non-viral vectors include liposomes, peptides, nanoparticles, emulsions, or encapsulated two or more phase systems or other suitable preparation. Thus, in certain embodiments a method, kit, or composition involves a non-viral vector with nucleic acid that is loaded and contacted to a tissue or cell. For example a liposome containing naked DNA encoding a membrane-independent CD59 protein having a modified GPI anchor that does not target a membrane, or a gene encoding a membrane-independent CD59 protein having no GPI anchor, is encapsulated in the liposome and the liposome is contacted to the tissue or cell such that the nucleic acid is effectively delivered to the tissue or cell for treatment of a complement-related disease.
Antibodies
The present invention relates also to diagnosing or prognosing presence or progression of macular degeneration and other complement disorders by determining extent of MAC deposition on a retina by immunohistochemistry, using antibodies that are specific for human MAC. The term “antibody” as referred to herein includes whole antibodies and any antigen binding fragment (i.e., “antigen-binding portion”) or single chains of these. A naturally occurring “antibody” is a glycoprotein including at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds.
As used herein, an antibody that “specifically binds to human MAC” is intended to refer to an antibody that binds to human MAC with a KD of 5×10−9 M or less, 2×10−9M or less, or 1×10−1° M or less. For example, the antibody is monoclonal or polyclonal. The terms “monoclonal antibody” or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for MAC or for a particular epitope of MAC. The antibody is an IgM, IgE, IgG such as IgG1 or IgG4.
Also useful for MAC assay is an antibody that is a recombinant antibody. The term “recombinant human antibody”, as used herein, includes all antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from an animal (e.g., a mouse). Mammalian host cells for expressing the recombinant antibodies used in the methods herein include Chinese Hamster Ovary (CHO cells) including dhfr− CHO cells, described in Urlaub and ChasM 1980 Proc. Natl. Acad. Sci. USA 77: 4216-4220, and used with a DH FR selectable marker, e.g., as described in R. J. Kaufman and P. A. Sharp, 1982 Mol. Biol. 159:601-621, NSO myeloma cells, COS cells and SP2 cells. In particular, for use with NSO myeloma cells, another expression system is the GS gene expression system shown in WO 87/04462, WO 89/01036 and EP 338,841. To produce antibodies, expression vectors encoding intact or a portion of the protein of interest are introduced into mammalian host cells, and the host cells are cultured for a period of time sufficient to allow for expression of the antibody in the host cells or secretion of the antibody into the culture medium in which the host cells are grown. Antibodies can be recovered from the culture medium using standard protein purification methods.
Standard assays to evaluate the binding ability of the antibodies toward the target of various species are known in the art, including for example, ELISAs, western blots and RIAs. The binding kinetics (e.g., binding affinity) of the antibodies also can be assessed by standard assays known in the art, such as by Biacore analysis.
General methodologies for antibody production, including criteria to be considered when choosing an animal for the production of antisera, are described in Harlow et al. (1988 Antibodies, Cold Spring Harbor Laboratory, pp. 93-117). For example, an animal of suitable size such as goats, dogs, sheep, mice, or camels are immunized by administration of an amount of immunogen, such as the intact protein or a portion thereof containing an epitope from human MAC, effective to produce an immune response. An exemplary protocol is as follows. The animal is subcutaneously injected in the back with 100 micrograms to 100 milligrams of antigen, dependent on the size of the animal, followed three weeks later with an intraperitoneal injection of 100 micrograms to 100 milligrams of immunogen with adjuvant dependent on the size of the animal, for example Freund's complete adjuvant. Additional intraperitoneal injections every two weeks with adjuvant, for example Freund's incomplete adjuvant, are administered until a suitable titer of antibody in the animal's blood is achieved. Exemplary titers include a titer of at least about 1:5000 or a titer of 1:100,000 or more, i.e., the dilution having a detectable activity. The antibodies are purified, for example, by affinity purification on columns containing human MAC.
The technique of in vitro immunization of human lymphocytes is used to generate monoclonal antibodies. Techniques for in vitro immunization of human lymphocytes are well known to those skilled in the art. See, e.g., Inai et al. May 1993 Histochemistry, 99(5): 335-362; Mulder et al. 1993 Hum. Immunol. 36(3): 186-192; Harada, et al. 1993 J. Oral Pathol. Med., 22(4): 145-152; Stauher, et al. 1993 J. Immunol. Methods 161(2): 157-168; and Venkateswaran, et al. 1992 Hybridoma, 11(6): 729-739. These techniques can be used to produce antigen-reactive monoclonal antibodies, including antigen-specific IgG, and IgM monoclonal antibodies.
Any antibody or fragment thereof having affinity and specific for human MAC is within the scope of the assay for MAC deposition provided herein.
The invention herein provides in one embodiment a method of assaying extent of macular degeneration (MD) arising from a complement component in a serum in a model cell system, the method including: exposing a first sample of cells to a sample of the serum and measuring resulting lysis, and comparing extent of lysis to that in a second sample of control cells not so exposed to the serum and otherwise identical, such that the extent of lysis in the first sample compared to that in the second sample is a measure of complement-induced MD.
In other embodiments, the invention provides methods of assaying a potential therapeutic agent for efficacy in treatment of human macular degeneration (MD) in a model cell system, the method including: contacting a first sample of cells to serum and measuring resulting lysis, and contacting a second sample of otherwise identical control cells with serum and a source of human CD59 protein and measuring resulting lysis; and contacting at least a third sample of cells to a candidate therapeutic composition and otherwise identically to serum and measuring lysis, such that the extent of lysis of the third sample compared to that in the first sample and the second sample is a measure of protection by the candidate composition, thereby assaying for a potential therapeutic agent for efficacy in treatment of human MD. The source of CD59 includes pure isolated CD59 without limitation, such as purified from a natural source or made recombinantly and purified, or delivered by a vector such as a viral vector or a nucleic acid vector, the vector encoding the CD59 and capable of expressing CD59 in vivo. In examples herein, contacting with CD59 is achieved by injecting cells or tissues with a vector encoding the CD59 gene.
In an embodiment of these methods, cell lysis is measured by propidium iodide (PI) uptake. PI is commercially available from, for example, Fluka BioChemica (Bucks, Switzerland). PI is an intercalating agent that fluoresces when bound to DNA. PI is membrane impermeant and generally excluded from viable cells, thus PI is commonly used to identify and/or determine the amount of non-living cells in a mixed population.
In other embodiments, the invention provides methods in a model cell system of assaying a serum complement component for prognosis or diagnosis of macular degeneration (MD), the method including: contacting detestably labeled cells with serum from a subject and measuring amount of extracellular and/or intracellular detectable agent for contacted cells; and comparing extracellular and/or intracellular agent in the cells to that in detectably labeled control cells not exposed to the serum and otherwise identical, such that amount of extracellular and/or intracellular agent in the contacted cells is compared to that in the control cells, such that a greater amount of extracellular detestably labeled agent in cells contacted with serum is an indication of prognosis or diagnosis of MD.
In other embodiments, the invention provides methods of assaying a potential therapeutic agent for efficacy in treatment of human macular degeneration (MD) in a model cell system, the method including: contacting a first sample of detectably labeled cells with serum from a subject and measuring amount of extracellular and/or intracellular detectable agent, and contacting a second sample of otherwise identical detectably labeled control cells with serum and a source of human CD59 protein and measuring amount of extracellular and/or intracellular detectable agent; and contacting at least a third sample of detectably labeled cells to at least one candidate therapeutic composition and otherwise identically to serum and measuring amount of extracellular and/or intracellular detectable agent, such that the amount of extracellular and/or intracellular detectable agent of the third sample compared to that in the first sample and the second sample is a measure of protection by the candidate composition, such that a greater amount of extracellular detectably labeled agent is an indication of MD, thereby assaying for a potential therapeutic agent for efficacy in treatment of human MD.
In embodiments of these methods, the detectable agent is, for example, a recombinant vector having a gene capable of expressing a detectable protein, a fluorescent agent, a colorimetric agent, an enzymatic agent, and a radioactive agent.
In certain embodiments, the detectable protein is a fluorescent protein, for example, green fluorescent protein, aequorin, cyan fluorescent protein, DsRed fluorescent protein, enhanced green fluorescent protein, and yellow fluorescent protein. Green fluorescent protein (GFP) and aequorin are bioluminescent compositions isolated from the jellyfish Aequorea victoria. When a calcium ion binds to acquorin, the complex breaks down into apoaequorin and a luminescent composition, which emits blue light. Synthetic aequorin is commercially available from Sealite, Sciences (Bogart, Ga.) as AQUALITE®. GFP emits light in the lower green portion of the visible spectrum, and synthetic GFP is commercially available from Clontech (Mountain View, Calif.).
Mutations to the amino acid sequence of GFP have been made to produce derivative amino acid sequences of GFP that fluoresce different colors, for example, cyan fluorescent protein, DsRed fluorescent protein, enhanced green fluorescent protein, and yellow fluorescent protein. Synthetic cyan fluorescent protein, synthetic DsRed fluorescent protein, synthetic enhanced green fluorescent protein, and synthetic yellow fluorescent protein are each commercially available from Clontech (Mountain View, Calif.).
In alternative embodiments, the detectable agent is a fluorescent agent that is not a fluorescent protein, for example, Indocyanine Green, Doxorubicin, Riboflavin, Chlorophyll, and Porphyrin.
Indocyanine Green (ICG) is a tricarbocyanine dye that upon excitation, emits lights at about 800 nm, about 820 nm, about 840 nm or at about 860 nm. ICG is commercially available from H.W.Sands Corp. (Jupiter, Fla.). Doxorubicin is fluorescent and emits light at wavelengths of, for example, about 550 nm, 600 nm, or 650 nm. Doxorubicin is commercially available from Sigma-Aldrich (St. Louis, Mo.). Riboflavin is commercially available from Sigma-Aldrich (St. Louis, Mo.) and is fluorescent, emitting light at a wavelength of, for example, about 450 nm, about 550 nm, about 650 nm, or about 750 nm. Chlorophyll A is a green photosynthetic pigment that emits light at a wavelength of, for example, about 600 nm, about 700 nm, or about 800 nm.
Chlorophyll A is commercially available from suppliers such as Sigma Chemical (St. Louis, Mo.) and Turner Designs (Sunnyvale, Calif.). Porphyrin is a heterocyclic macrocycle made from 4 pyrrole subunits linked on opposite sides through 4 methine bridges (═CH—). The extensive conjugated structure of Porphyin makes the compound chromatic, i.e., fluorescent at a wavelength of, for example, about 600 nm, or about 650 nm, or about 700 nm. Porphyrin is commercially available from Sigma-Aldrich (St. Louis, Mo.).
In other alternative embodiments, the detectable agent is an enzymatic agent which is a protein, for example, β-galactosidase or alkaline phosphatase, that can be expressed on a nucleotide vector.
β-galactosidase is a hydrolase enzyme that catalyzes the hydrolysis of 3-galactosides into monosaccharides. A luminescent P-galactosidase detection kit is commercially available from Clontech (Mountain View, Calif.). Alkaline phosphatase is a hydrolase enzyme responsible for removing phosphate groups from many types of molecules, including nucleotides, proteins, and alkaloids. A luminescent alkaline phosphatase detection kit is commercially available from Sigma Aldrich (St. Louis, Mo.).
Pharmaceutical Compositions
An aspect of the present invention provides pharmaceutical compositions that include a CD59-encoding nucleic acid or a source of CD59 protein expression. In various embodiments, the CD59 protein includes a membrane-independent CD59 protein. In certain embodiments, the pharmaceutical composition is compounded as an ophthalmologic formulation for administration to the eye and may be compounded to enhance delivery to the fundus, to provide sustained release locally at the retina or otherwise formulated to provide effective treatment of the vessels and/or tissue involved in ocular diseases including macular degeneration. In related embodiments, the pharmaceutical composition is formulated sufficiently pure for administration to a human subject, e.g., to the eye of a human subject. In certain embodiments, these compositions optionally further include one or more additional therapeutic agents. In certain embodiments, the additional therapeutic agent or agents are selected from the group consisting of growth factors, anti-inflammatory agents, vasopressor agents including but not limited to nitric oxide and calcium channel blockers, collagenase inhibitors, topical steroids, matrix metalloproteinase inhibitors, ascorbates, angiotensin II, angiotensin III, calreticulin, tetracyclines, fibronectin, collagen, thrombospondin, transforming growth factors (TGF), keratinocyte growth factor (KGF), fibroblast growth factor (FGF), growth factors (IGFs), IGF binding proteins (IGFBPs), epidermal growth factor (EGF), platelet derived growth factor (PDGF), neu differentiation factor (NDF), hepatocyte growth factor (HGF), vascular endothelial growth factor (VEGF), heparin-binding EGF (HBEGF), thrombospondins, von Willebrand Factor-C, heparin and heparin sulfates, and hyaluronic acid.
In other embodiments, the additional agent is a compound, composition, biological or the like that potentiates, stabilizes or synergizes or even substitutes for the ability of CD59 protein to protect cells from MAC deposition. Also included are therapeutic agents that may beneficially or conveniently be provided at the same time as the CD59 protein, such as agents used to treat the same, a concurrent or a related symptom, condition or disease. In some embodiments, the drug may include without limitation anti-tumor, antiviral, antibacterial, anti-mycobacterial, anti-fungal, anti-proliferative or anti-apoptotic agents. Drugs that are included in the compositions of the invention are well known in the art. See for example, Goodman & Gilman's The Pharmacological Basis of Therapeutics, 9th Ed., Hardman, et al., eds., McGraw-Hill, 1996, the contents of which are herein incorporated by reference herein.
As used herein, the term “pharmaceutically acceptable carrier” includes any and all solvents, diluents, or other liquid vehicle, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage foul′ desired. Remington's Pharmaceutical Sciences Ed. by Gennaro, Mack Publishing, Easton, Pa., 1995 provides various carriers used in formulating pharmaceutical compositions and known techniques for the preparation thereof. Some examples of materials which can serve as pharmaceutically acceptable carriers include, but are not limited to, sugars such as glucose and sucrose; excipients such as cocoa butter and suppository waxes; oils such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil, and soybean oil; glycols such a propylene glycol; esters such as ethyl oleate and ethyl laurate; agar; buffering agents such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol; and phosphate buffer solutions, as well as other non-toxic compatible lubricants such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, releasing agents, coating agents, preservatives and antioxidants can also be present in the composition, according to the judgment of the formulator.
Therapeutically Effective Dose
Treatment of a complement by methods provided herein involves contacting a tissue or cells with a pharmaceutical composition, for example, administering a therapeutically effective amount of a pharmaceutical composition having as an active agents a nucleic acid encoding a CD59 protein or a source of expression of a CD59 protein, to a subject in need thereof, in such amounts and for such time as is necessary to achieve the desired result. Methods for example include treating AMD by contacting an ocular tissue or cell with CD59 protein or a vector encoding the CD59 protein.
The compositions, according to the method of the present invention, may be administered using any amount and any route of administration effective for treating AMD or other complement-related diseases and conditions. Thus, the expression “amount effective for treating AMD”, as used herein, refers to a sufficient amount of composition to beneficially prevent or ameliorate the symptoms of AMD.
The exact dosage is chosen by the individual physician in view of the patient to be treated. Dosage and administration are adjusted to provide sufficient levels of the active agent(s) or to maintain the desired effect. Additional factors which may be taken into account include the severity of the disease state, e.g., intermediate or advanced stage of AMD; age, weight and gender of the patient; diet, time and frequency of administration; route of administration; drug combinations; reaction sensitivities; and tolerance/response to therapy. Long acting pharmaceutical compositions might be administered hourly, twice hourly, every 3 to four hours, daily, twice daily, every 3 to 4 days, every week, or once every two weeks depending on half-life and clearance rate of the particular composition.
The active agents of the invention are preferably formulated in dosage unit form for ease of administration and uniformity of dosage. The expression “dosage unit form” as used herein refers to a physically discrete unit of active agent appropriate for the patient to be treated. It will be understood, however, that the total daily usage of the compositions of the present invention will be decided by the attending physician within the scope of sound medical judgment. For any active agent, the therapeutically effective dose can be estimated initially either in cell culture assays or in animal models, as provided herein, usually mice, but also potentially from rats, rabbits, dogs, or pigs. The animal cell model provided herein is also used to achieve a desirable concentration and total dosing range and route of administration. Such information can then be used to determine useful doses and routes for administration in humans.
A therapeutically effective dose refers to that amount of active agent that ameliorates the symptoms or condition or prevents progression of AMD. Therapeutic efficacy and toxicity of active agents can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., ED50 (the dose is therapeutically effective in 50% of the population) and LD50 (the dose is lethal to 50% of the population). The dose ratio of toxic to therapeutic effects is the therapeutic index, and it can be expressed as the ratio, LD50/ED50. Pharmaceutical compositions which exhibit large therapeutic indices are preferred. The data obtained from cell culture assays and animal studies are used in formulating a range of dosage for human use.
The daily dosage of the products may be varied over a wide range, such as from 0.001 to 100 mg per adult human per day. For ocular administration, the compositions are preferably provided in the form of a solution containing 0.001, 0.01, 0.05, 0.1, 0.5, 1.0, 2.5, 5.0, 10.0, 15.0, 25.0, 50.0, 100.0, 250.0, or 500.0 micrograms of the active ingredient for the symptomatic adjustment of the dosage to the patient to be treated.
A unit dose typically contains from about 0.001 micrograms to about 500 micrograms of the active ingredient, preferably from about 0.1 micrograms to about 100 micrograms of active ingredient, more preferably from about 1.0 micrograms to about 10 micrograms of active ingredient. An effective amount of the drug is ordinarily supplied at a dosage level of from about 0.0001 mg/kg to about 25 mg/kg of body weight per day. For example, the range is from about 0.001 to 10 mg/kg of body weight per day, or from about 0.001 mg/kg to 1 mg/kg of body weight per day. The compositions may be administered on a regimen of, for example, one to four or more times per day. A unit dose may be divided for example, administered in two or more divided doses.
Administration of a source of expression of a CD59 protein is administration of a dose of a viral vector or a nucleic acid vector, such that the dose contains at least about 50, 100, 500, 1000, or at least about 5000 particles per cell to be treated. Cell number can be calculated from retinal area in need of treatment by methods known to one of skill in the art of AMD.
Administration of Pharmaceutical Compositions
As formulated with an appropriate pharmaceutically acceptable carrier in a desired dosage, the pharmaceutical composition provided herein is administered to humans and other mammals topically such as ocularly (as by solutions, ointments, or drops), nasally, bucally, orally, rectally, parenterally, intracisternally, intravaginally, or intraperitoneally.
Ocular injections include intra-ocular injection into the aqueous or the vitreous humor, or injection into the external layers of the eye, such as via subconjunctival injection or subtenon injection.
Liquid dosage forms for ocular, oral, or other systemic administration include, but are not limited to, pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs. In addition to the active agent(s), the liquid dosage forms may contain inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. Besides inert diluents, the ocular, oral, or other systemically-delivered compositions can also include adjuvants such as wetting agents, and emulsifying and suspending agents.
Dosage forms for topical or transdermal administration of an inventive pharmaceutical composition include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants, or patches. The active agent is admixed under sterile conditions with a pharmaceutically acceptable carrier and any needed preservatives or buffers as may be required. For example, ocular or cutaneous routes of administration are achieved with aqueous drops, a mist, an emulsion, or a cream. Administration may be therapeutic or it may be prophylactic. The invention includes ophthalmological devices, surgical devices, audiological devices or products which contain disclosed compositions (e.g., gauze bandages or strips), and methods of making or using such devices or products. These devices may be coated with, impregnated with, bonded to or otherwise treated with a composition as described herein.
Transdermal patches have the added advantage of providing controlled delivery of the active ingredients to the body. Such dosage forms can be made by dissolving or dispensing the compound in the proper medium. Absorption enhancers can also be used to increase the flux of the compound across the skin. The rate can be controlled by either providing a rate controlling membrane or by dispersing the compound in a polymer matrix or gel.
Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation may also be a sterile injectable solution, suspension or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution, U.S.P. and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid are used in the preparation of injectables. The injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use. In order to prolong the effect of an active agent, it is often desirable to slow the absorption of the agent from subcutaneous or intramuscular injection. Delayed absorption of a parenterally administered active agent may be accomplished by dissolving or suspending the agent in an oil vehicle. Injectable depot forms are made by forming microencapsule matrices of the agent in biodegradable polymers such as polylactide-polyglycolide. Depending upon the ratio of active agent to polymer and the nature of the particular polymer employed, the rate of active agent release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are also prepared by entrapping the agent in liposomes or microemulsions which are compatible with body tissues.
Compositions for rectal or vaginal administration are preferably suppositories which can be prepared by mixing the active agent(s) of this invention with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active agent(s).
Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules. In such solid dosage farms, the active agent is mixed with at least one inert, pharmaceutically acceptable excipient or carrier such as sodium citrate or dicalcium phosphate and/or a) fillers or extenders such as starches, sucrose, glucose, mannitol, and silicic acid, b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia, c) humectants such as glycerol, d) disintegrating agents such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, e) solution retarding agents such as paraffin, f) absorption accelerators such as quaternary ammonium compounds, g) wetting agents such as, for example, cetyl alcohol and glycerol monostearate, h) absorbents such as kaolin and bentonite clay, and i) lubricants such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof.
Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as milk sugar as well as high molecular weight polyethylene glycols and the like. The solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings, release controlling coatings and other coatings well known in the pharmaceutical formulating art. In such solid dosage & gins the active agent(s) may be admixed with at least one inert diluent such as sucrose or starch. Such dosage foiins may also comprise, as is normal practice, additional substances other than inert diluents, e.g., tableting lubricants and other tableting aids such a magnesium stearate and microcrystalline cellulose. In the case of capsules, tablets and pills, the dosage forms may also comprise buffering agents. They may optionally contain opacifying agents and can also be of a composition that they release the active agent(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions which can be used include polymeric substances and waxes.
The invention having now been fully described, it is further illustrated by the following examples and claims, which are illustrative and are not meant to be further limiting.
A portion of this work was published in a paper entitled, “Soluble CD59 Expressed from an Adenovirus In Vivo is a Potent Inhibitor of Complement Deposition on Murine Liver Vascular Endothelium”, co-authored by Jarel Gandhi, Siobhan M. Cashman, and Raj endra Kumar-Singh, (PLoS One. 2011; 6(6): e21621), which is hereby incorporated by reference herein in its entirety.
The invention now having been fully described, it is further exemplified by the following examples and claims. Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures described herein. Such equivalents are within the scope of the present invention and claims. The contents of all references including issued patents and published patent applications cited in this application are hereby incorporated by reference in their entirety.
EXAMPLESCompositions that include a nucleic acid encoding a CD59 protein or a source of in vivo expression of CD59 protein are shown by the following Examples to be effective to treat AMD or other complement-related conditions. A humanized murine model of measuring human MAC deposition in vitro and in vivo is shown in the following Examples, and this model is used to measure protection of murine RPE from the deleterious deposition of human MAC by a vector that expresses human CD59 protein.
Example 1: Adenovirus Vector ConstructsHuman CD59 eDNA was obtained from the American Type Tissue Culture Collection (ATCC, Manassas, Va.) and PCR amplified using a forward primer containing an XhoI site (underlined; 5′ccccetcgagtggacaatcacaatggg3′; SEQ ID NO:1) and a reverse primer with an EcoRV site (underlined; 5′cceccgatatcaacggggagntgggagaag3′; SEQ lll NO:2).
The PCR product was gel purified and, after XhoI/EcoRV digestion, cloned into XhoI/EcoRV digested pShCAG (constructed by cloning a SalI/BamHI fragment of pCAGEN into XhoI/BglI1 digested pShuttle) generating pShCAGCD59. Automated sequencing confirmed that the CD59 sequence had been introduced into the generated plasmid. This shuttle plasmid was then used to produce the adenovirus vector using protocols published in Klein et al. 2007 Ophthalmology 114: 253-262, and van Leeuwen et al. 2003 Bur. J. Epidemiol. 18: 845854. pShCAGCD59 was linearized with PmeI, gel purified and recombined with pAdEasy-1 by co-transformation of Escherichia coli BJ5183 cells. The recombined plasmid was linearized with PacI, transfected into the human embryonic retinoblast (911) cell line and the resulting vector (AdCAGCD59) was purified using the adenovirus purification kit Adenopure (Puresyn, Inc., Malvern, Pa.).
Control vector AdEMPTY was generated similarly by recombining the PmeI linearized pSHCAG with pAdEasy-1. The AdCAGGFP control vector is described in Johnson et al. 2000 Exp. Eye Res. 70: 441-449.
Example 2: Contacting Cell Lines with Adenovirus Expressing CD59Human embryonic retinoblast cell line 911 was maintained in Dulbecco's Modified Eagle's Medium (DMEM) supplemented with 10% fetal bovine serum (FBS) and mouse hepatoma cell line hepa-le c7 (ATCC, Manassas, Va.) in a-MEM supplemented with 10% FBS. Cells were cultured in a humidified incubator at 37° C. under 5% CO—): 95% air atmosphere. For Western blot analysis or the human serum cell lysis assay hepa-lcic7 (1.2×106) cells were contacted and for CD59 immunocytochemistry or the human serum MAC deposition assay 2.5×104 hepa-lc1c7 cells were contacted with either AdCAGGFP or AdCAGCD59 vectors at multiplicities of infection of the virus particles per cell as indicated, or control cells were not so contacted. Adenovirus vector contacting to cells was performed in media with 2% FBS. Three days after contacting, cells were further treated as described in Examples herein. While specific conditions are described herein, equivalent conditions of media, temperature, etc., to achieve effective treatment of cells or tissues with CD59 are within the scope of the methods herein.
Primary Mouse RPE cells were harvested from eyes of sacrificed six to ten week old C57B1/61 mice. After removing each of the anterior chamber, lens and retina as described below, eyecup tissues were incubated in 200 ul 0.25% trypsin-EDTA in 1.5 ml eppendorf tubes for 40 to 50 minutes at 37° C. Eyecup tissues were subsequently transferred to a 60 mm cell culture plate containing a-MEM supplemented with 10% FBS. The RPE cells were gently scraped with a pipet tip, and the RPE sheets were aspirated using a 200 al pipet and transferred to an eppendorf tube. After dispersing the RPE sheets by pipeting the media several times, cells were counted and about 3×104 cells (generally the yield obtained from one eye) were seeded in one chamber of a poly-D-lysine-coated chamberslide (Becton Dickinson, Franklin Lakes, N.J.). After one week in culture, cells were used as described in Examples herein. Contacting cells with adenovirus vector was performed in media with 2% FBS.
Example 3: Western Blot AnalysisCells were lysed in 50 mM Tris-HCl, pH 8.0/150 mM NaCl/0.1% sodium dodecyl sulfate/1% Triton X-100 containing 2% (v:v) protease inhibitor cocktail (Sigma-Aldrich, St. Louis, Mo.). Media from cells were collected, centrifuged, and passed through a. 0.22 um filter or other filter as indicated in the figures, to remove remaining cell debris and media were concentrated 10× using a Biomax centrifugal filter with a 10,000 Dalton pore size (Millipore Corporation, Billerica, Mass.). Lysates were analyzed by gel electrophoresis under non-reducing conditions on a 15% Tris-glycine SDS-PAGE gel (Bio-Rad Laboratories, Hercules, Calif.) and proteins were transferred to a polyvinylidene fluoride (PVDF) membrane (Millipore, Billerica, Mass.). Following blocking in 5% (w:v) skim milk (Becton Dickinson, Sparks, Md.), the membrane was probed for human CD59 using a mouse anti-human CD59 monoclonal antibody (1:1000 dilution; Clone Mem-43; Abeam, Cambridge, Mass.), followed by a secondary antibody horseradish peroxidasc-conjugated goat anti-mouse antibody (1:10,000 dilution; Jackson Immunoresearch, West Grove, Pa.). Following stripping and blocking as described above, the same membrane was probed for p-Actin with a mouse anti-β-actin monoclonal antibody (1:5,000 dilution; Clone AC-15; Sigma-Aldrich, St. Louis, Mo.). Secondary detection was performed as described above.
Example 4: Human Serum Cell Lysis AssayNornial human serum (NHS) was purchased in lyophilized form from Sigma (St. Louis, Mo.) and reconstituted (per manufacturer instructions) with one milliliter (ml) of cold sterile deionized water to obtain a volume of serum equal to that of the human plasma from which the powder was obtained. The resulting human serum lots having a hemolytic titer of 43 CH50 units/ml or 74 CH50 units/ml respectively (determined by the manufacturer using the method of Kabat and Mayer) were aliquoted and stored at −80° C. The first lot with a hemolytic titer of 43 CH50 units/ml was used in experiments with hepa-lcl c7 cells. The second lot, with a hemolytic titer of 74 CH50 units/ml, was used in the other experiments.
For the human serum cell lysis assay, single cell suspensions of contacted cells, i.e., including control cells not contacted with vector, or adenovirus contacted hepa-lcl c7 cells in a total volume of 500 td were used. Following removal of media, cells were washed twice with 1× phosphate buffered saline (PBS) and after brief trypsinization (0.25% trypsin-EDTA, 4-6 mins), harvested with 1×PBS containing 0.5% FBS. Cells were collected by centrifugation at 4° C. and re-suspended in ice-cold gelatin veronal buffer with Ca2+ and Mg2+ (GVB++, Complement Technology, Tyler, Tex.). Cells were counted on a hemacytometer and 5×105 cells were aliquoted into eppendorf tubes. Normal human serum (NHS) or heat inactivated (56° C. for one hour) normal human serum (HI-NHS) was added to cells, and the cell suspensions were incubated at 37° C. for one hour with gentle rotatory shaking. Cell lysis was determined by the propidium iodide (PI) exclusion method followed by FACS analysis.
Shortly prior to FACS, one microliter of PT (1 mg/ml; Fluka BioChemica, Buchs, Switzerland) was added to a cell suspension and 25,000 events per sample were counted on a FACSCalibur (Becton Dickinson, Franklin Lakes, N.J.). Results were analyzed using the CellQuest Pro software (Becton Dickinson, Franklin Lakes, N.J.) and percent cell lysis was calculated using the formula shown below.
% Cell Lysis=[1−(% live cells in HI-NHS/% live cells in NHS)]×100
Mouse hepa-1cl c7 cells were cultured for three days, and were contacted with AdCAGGFP (negative control), or AdCAGCD59, in poly-D-lysine-coated chamberslides (Becton Dickinson, Franklin Lakes, N.J.) and were washed twice with 1×PBS. Cells were then incubated with 10% (v:v) NHS or HI-NHS in GVB++ (Complement Technology, Tyler, Tex.) at 37° C. for one, three, five, seven or ten minutes.
Primary mouse RPE cells were incubated with or without 25 μg/ml goat anti-mouse emmprin antibody (R&D Systems, Minneapolis, Minn.) in GVB (Complement Technology, Tyler, Tex.) for one hour and either washed and fixed (for emmprin immunocytochemistry) or were treated for the MAC deposition assay followed by addition of NHS or HI-NHS (final concentration 50%) for four or seven minutes. Thereafter cells were washed three times with ice cold 1×PBS and fixed with 3.7% formaldehyde (MP Biomedicals, Solon, Ohio) in 1×PBS for 15 minutes. Cells were washed another three times with 1×PBS to remove remaining fixative and stored in 1×PBS at 4° C. until immunocytochemical analysis, as described in Examples herein.
Example 6: Immunocytochemistry/ImmunohistochemistryFixed cells or tissues described above were incubated with primary mouse monoclonal antibodies specific to human CD59 (clone M-43) or human C5b-9 (clone aEl 1) (each at 1:50 dilution, Abeam, Cambridge, Mass.) in 1×PBS containing 6% (w:v) normal goat serum (Jackson Immunoresearch, West Grove, Pa.) for 2.5 hours with gentle rotatory shaking. Secondary detection was performed using a Cy3 conjugated goat anti-mouse antibody (1:400 dilution; Jackson hnmunoresearch, West Grove, Pa.) for 1.5 hours in a dark chamber.
For RPE6S immunostaining, primary RPE cells were pre-blocked and peimeabilized in 1×PBS containing 6% (w:v) normal goat serum (Jackson Immunoresearch, West Grove, Pa.) and 0.25% (v:v) Triton X-100 (Fisher Bio-reagents, Fair Lawn, N.J.) for one hour. A mouse anti-RPE65 antibody was then applied and primary and secondary detection were perfoinied as above except that the antibody and washing solutions contained 0.25% (v:v) Triton X-100 (Fisher Bio-reagents, Fair Lawn, N.J.).
For mouse emmprin staining, goat anti-mouse emmprin antibody treated and fixed cells and tissues were blocked in 1×PBS containing 6% (w: v) normal donkey serum (Jackson Immunoresearch, West Grove, Pa.) for one hour and secondary detection was performed using a Cy3-conjugated donkey anti-goat antibody (1:400 dilution; Jackson Immunoresearch, West Grove, Pa.) in 1×PBS containing 6% (w:v) normal donkey serum for 1.5 hours.
Example 7: Trypan Blue Exclusion AssayCells were treated as for the MAC deposition assay in cell culture as described in Examples above, except that after washing to remove the serum, cells were incubated in 0.1% trypan blue solution for five minutes. Cells were subsequently washed twice with 1×PBS and fixed as described in Examples above.
Example 8: Subretinal InjectionsMice (C57Bl/6J) were purchased from Jackson Laboratories (Bar Harbor, Me.), bred and maintained in a twelve-hour light-dark cycle. Mice were anesthetized by intraperitoneal injection of xylazine (10 mg/ml)/ketamine (1 mg/ml). Subretinal injections were performed as described in Anderson 2002 Am J Ophthalmol. 134: 411-431, using the transcleral-transchoroidal approach with a 32-gauge needle attached to a five microliter (p1) glass syringe (Hamilton, Reno, Nev.). One microliter of a control mixture of nine parts AdEMPTY and one part AdCAGGFP (total of 3×108 vector particles; control) or of a mixture of nine parts AdCAGCD59 and one part AdCAGGFP (total of 3×108 vector particles) was injected into each subject mouse.
Example 9: MAC Deposition on RPE and CorneaSix days after administering injection, mice were sacrificed by carbon dioxide inhalation and eyes were harvested and placed in 1×PBS containing penicillin (100 U/ml) and streptomycin (100 U/ml). A circular incision was made 1-2 mm posterior to the ora serata and the entire anterior chamber including the lens was carefully removed. After making a small incision at the base of the optic nerve to cut the ganglionic axons, the retina was removed and the eyecup tissue was either fixed immediately in 4% parafoiuialdehyde in phosphate buffer (pH 7.4) overnight (for CD59 immunohistochemistry) or incubated with 25 μg/ml goat anti-mouse emmprin antibody (R&D Systems, Minneapolis, Minn.) in cold GVB″− (Complement Technology, Tyler, Tex.) at 4° C. for one hour.
Eyecup tissues were then either washed three times with cold PBS and were fixed for emmprin immunohistochemistry. For MAC deposition assay, an equal volume of NHS or HI-NHS (final concentration 50%) was added to the eyecup tissues which were then incubated at 37° C. for 15 minutes, were washed three times with cold PBS and were fixed.
Cornea tissues were harvested from uninjected mice, the iris was removed and the corneas cultured in 300 μl of DMEM with 2% FBS. Corneas were contacted with 1.5×109 vector particles of AdCAGGFP (negative control) or the AdCAGCD59 vector. Three days following harvesting/contacting, each of untreated corneas (negative control), AdCAGGFP contacted corneas (negative control) and AdCAGCD59 contacted corneas was mixed with anti-mouse emmprin antibody as with eyecup tissues, and each was either washed and fixed (for emmprin immunohistochemistry), or was contacted with 50% NHS or HI-NHS for 20 minutes and then washed and fixed (for the MAC deposition assay). Prior to immunohistochemistry, tissues were washed three times for ten minutes each with 1×PBS to remove remaining fixative.
Example 10: Vector Constructs and Human CD59 Expression in Vector Contacted Hepa-lcl c7 CellsTo deliver human CD59 (hCD59) to murine RPE and retina in vivo, a first generation serotype 5 adenovirus containing hCD59 cDNA under control of chicken beta actin (CAG) promoter (AdCAGCD59 vector;
Endogenous hCD59 was detected in human embryonic retinoblast (911) cell lysates (
Immunostaining of non-permeabilized AdCAGCD59 contacted mouse hepa-lcic7 cells using the anti-hCD59 antibody showed expression and localization of hCD59 on the cell membrane (
To test the functional activity of hCD59 expressed from the AdCAGCD59 vector, human serum cell lysis assays were performed on mouse hepa-1 cic7 cells. Cell suspensions were incubated with NHS or HI-NT-IS (as a control for non-complement specific lysis) to expose the cells to complement, and percent cell lysis was deteimined by uptake of PI as detected and quantified by FACS analysis.
Effect of concentration of serum on the extent of lysis of control untreated cells was initially investigated (
Cells were contacted with 1000 vp/cell of the AdCAGCD59 or the negative control AdCAGGFP vector and 65 hours after contacting, the cells were harvested and used in human serum cell lysis experiments. Adenovirus amounts used herein did not result in cell toxicity as observed by microscopy or as detected by PI uptake followed by FACS, and by comparison with data obtained from cells contacted with the two vectors and from control untreated cells as shown herein. It was observed that cell lysis of contacted cells incubated in HI-NHS was minimal and was similar to that of cells not contacted with a vector (control) incubated with HI-NFIS (
In contrast, mouse cells contacted with the negative control AdCAGGFP vector were not protected, i.e., remained susceptible to human complement, with extent of complement mediated cell lysis observed at 95.27%±0.01% of cells (
Protection of cells from lysis was obtained herein by expression of human CD59 in cells contacted with AdCAGCD59 vector. It was further observed that protection was dependent on the multiplicity of AdCAGCD59 vector administered. Administering 250 vp/cell and 500 vp/cell of AdCAGCD59, respectively, inhibited cell lysis by over 50% and 70%, respectively (
Data in Examples above show that incubation of mouse hepa-lcl c7 cells with normal human serum led to complement activation and extensive cell lysis, and that this lysis was efficiently inhibited when recombinant human CD59 was expressed in these cells.
Examples were performed to determine whether recombinant human CD59 expressed by adenovirus contacted mouse cells would prevent formation of the C5b-9 complex in an in vitro MAC deposition assay developed for this purpose.
Mouse cells in poly-D-lysine coated chamberslides were incubated with 10% NHS or HI-NHS in GV−B+− at 37° C. for one to ten minutes and subsequently washed and fixed. Incubation of these cells with NHS for five minutes caused significant changes in cell morphology (
Immunocytochemical analysis using a monoclonal antibody directed to a neo-epitope on the C5b-9 complex revealed extensive membrane staining at the borders of cells exposed to NHS confirming deposition of the MAC on these cells (
Transfecting the mouse hepa-1cic7 cells with 1000 vp/cell of the AdCAGCD59 vector was found to significantly protect these cells from human MAC deposition and eventual lysis (
It was observed that MAC staining was present on even a few of the AdCAGCD59 contacted cells following seven minutes of NHS treatment (
The different patterns of MAC immunostaining was more readily observed when cells were pre-contacted at lower multiplicities of the AdCAGCD59 vector. Following five minutes of NHS exposure, cells contacted with 100 or 500 vp/cell showed more MAC immunostaining compared to cells contacted with 1000 vp/cell (
A MAC deposition assay was developed in order to use murine ocular tissues to assay extent of AMD damage or potential for AMD, and to use to screen agents to treat or prevent AMD.
Eyecup tissues were harvested from C57Bl/6J mice and exposed to various concentrations of NHS or HT-NITS. Inimunohistochernical analysis with the anti-human C5b-9 antibody was followed by an appropriate Cy3 conjugated secondary antibody. The data showed no fluorescent signal on the RPE, even when eyecup tissues were contacted with a concentration of NHS as high as 50%. Contacting with 100% NHS resulted in occasional scattered weak staining (
The MAC deposition assay was perfoLnied on primary mouse RPE cells in order to further explore the absence of MAC deposition on murine RPE cells following exposure to human serum, and to determine whether the extracellular matrix on the ocular tissues was interfering with accessibility of complement proteins to the RPE or endothelial cell surface. RPE cells were identified by presence of typical pigmentation, characteristic morphology and routine immunostaining for the RPE cell marker, RPE65 (
The absence of extensive MAC deposition on the RPE and corneal endothelium upon exposure to NHS could be due to inefficient complement activation and/or enhanced protection by murine complement regulatory proteins expressed on the surface of these cells. To determine if complement activation on murine RPE could be enhanced, an antibody against the extracellular domain of mouse emmprin, which is an abundantly expressed membrane protein on RPE as well as corneal endothelium was next used. An anti-mouse emmprin antibody produced in goat was selected to avoid potential cross-reactivity with the secondary antibody (Cy3-conjugated goat anti-mouse IgG and IgM) used for MAC immunostaining.
Incubation of mouse eyecup tissues or cornea tissues with the anti-mouse emmprin antibody followed by exposure to NHS (final concentration 50% for 15 minutes eyecup tissues, or 20 minutes cornea tissues at 37° C.) yielded extensive, bright MAC immunostaining of the RPE dissected tissue (
Similar results were also obtained with primary passage 0 mouse RPE cells (
To further investigate the effects of MAC deposition and protection, primary (passage 0) mouse RPE cells were contacted with either a mixture of AdCAGCD59+AdCAGGFP (800+200 vpicell respectively) or with a control mixture of AdEMPTY AdCAGGFP (800+200 vp/cell respectively). After seven minutes of NHS treatment, washing and fixation, cells were examined. Three days post-treatment, these cells were analyzed by the MAC deposition assay.
Presence of numerous GFP-positive vesicles associated with cells was observed (
Efficacy of hCD59 to protect murine RPE from human MAC deposition was assessed. Mice were administered in vivo subretinal injections of each adenovirus vector. Six days after injection, expression of hCD59 on murine RPE following subretinal injection of the AdCAGCD59 vector was observed by immunohistochemistry with anti-hCD59 antibody (
For the MAC deposition assay, subretinal injections were perfoinied in two groups of mice. Mice in one group were injected with a mixture of AdCAGCD59 and AdCAGGFP vectors in a 9:1 ratio (AdCAGGFP was co-injected to allow easy identification of the injection site and area of transgene expression by spontaneous fluorescence). Mice from the second group were injected with a control mixture of AdEMPTY and AdCAGGFP (negative controls) also in a 9:1 ratio. Six days after injection, eyes were harvested and eyecup tissues were exposed to anti-mouse emmprin and NHS, along with eyecup tissues from uninjected control mice.
Immunohistochemistry for human MAC of eyecup tissues injected with the mixture of AdCAGCD59 and AdCAGGFP (n=10) showed significantly reduced staining on the RPE at the area of GFP expression (which was used to identify and was found to correlate with hCD59 expression) compared to the uncontacted remaining area of eyecup tissue (
Quantification of the MAC immunofluorescence at the area of GFP expression revealed an overall reduction of −55% in mean MAC immunofluorescenec intensity on the eyecup tissues injected with the mixture of AdCAGCD59 and AdCAGGFP (n=10) compared to eyecup tissues injected with the mixture of the negative control (n=10), a difference which was statistically significant (p=0.0014,
Eyecups were then contacted with mixtures of AdEMPTY and AdCAGGFP, or AdCAGCD59 and AdCAGGFP to analyze the possibility that reduced MAC was a function of transduction of the vector. No significant difference was observed in results between the two groups (n=10 per group) in GFP levels (
Quantification of reduction in MAC immunofluorescence at the area of GFP expression revealed an average of about 68% (13=0.0018) at 7.5 minutes NHS treatment and 56% (p=0.0007) at 15 minutes NHS treatment on the AdCAGCD59+AdCAGGFP-contacted eyecups compared to AdEMPTY+AdCAGGFP-contacted eyecups (
It is possible that the difference in MAC deposition between AdCAGCD59 and negative control contacted eyecup tissues was due to a difference in mouse emmprin expression and/or to a difference in anti-emmprin antibody binding. To evaluate this possibility, immunohistochcmistry for mouse emmprin on eyecup tissues contacted by pretreatment with the mixture of AdCAGCD59 and AdCAGGFP or eyecup tissues contacted with the negative control (mixture of AdEMPTY+AdCAGGFP) was performed. Anti-mouse emmprin antibody analysis was performed using the same procedure as for the MAC deposition assay, and eyecup tissues were washed, fixed and incubated with an appropriate Cy3-conjugated antibody. No differences in emmprin immunofluorescence on the RPE were observed between the area of transgcnc expression and the rest of the eyecup tissue (
No differences in emmprin immunofluorescence were observed between the areas of transgene expression of the mixture of AdCAGCD59+AdCAGGFP, and in control injected eyecups (
Primary murine RPE cells contacted with AdCAGGFP (
Protection from MAC deposition was not due to differences in emmprin expression and/or anti-emmprin antibody binding as immunocytochemistry for mouse emmprin revealed no differences between control and. AdCAGCD59 contacted cells. The data described demonstrate the destructive effects of human MAC deposition on the RPE and on primary RPE cells and significant protection of these cells by expression of hCD59.
Example 16: Protection of Corneal Endothelium from MAC Deposition by Vector-Mediated Delivery of hCD59MAC deposition and protection by adenovirus-delivered hCD59 was further assayed using murine corneal epithelium. Corneal epithelium is easily accessible tissue and cultured, and was contacted with adenovirus and other vectors in vivo and ex vivo. In addition, assays herein using corneal endothelium were shown to be efficient for homogenous transduction of the endothelial cells and efficient measurement of other factors such as agents that affect complement regulators. Investigation of MAC deposition on corneal endothelium is further useful for screening inhibitors of MAC deposition and complements testing in RPE in vitro and in vivo.
Delivery ex vivo of hCD59 to the corneal endothelium was observed herein to significantly protect those cells from human MAC deposition upon further mixing with the anti-mouse emmprin antibody and 50% NHS for 20 minutes (
Contacting corneas with the anti-mouse emmprin antibody followed by addition of 50% NHS for 20 minutes at 37° C. resulted in extensive, bright MAC immunostaining on the corneal endothelium (
Expression of hCD59 on the corneal endothelium following ex vivo infection with the AdCAGCD59 was observed by immunohistochemistry using the anti-hCD59 antibody, and no staining for hCD59 was observed on control (AdCAGGFP)-contacted corneas (
The protection from MAC deposition on the corneal endothelium of AdCAGCD59-contacted corneas was shown not to be due to a difference in emmprin expression and/or anti-emmprin antibody binding, as immunohistochemistry data showed no differences in emmprin immunostaining on the corneal endothelium of each of AdCAGCD59 and AdCAGGFP-contacted, and control (not contacted) corneas (
These data further show that hCD59 pretreatment protects ocular tissues from MAC deposition. Protection on the corneal endothelium was observed to be higher than that of the RPE. Additional factors might affect this protection, such as higher and more homogenous transduction of endothelium of ex vivo contacted corneas and efficiency of modulators and regulators of serum components, and of other possible agents that affect macular degeneration.
Example 17: Soluble Secreted hCD59 Construct and Human CD59 Expression in Vector-Contacted CellsThe CD59 constructs used in examples above were constructed to express a membrane associated protein through a GPI linker. Human CD59 lacking the sequence coding for the C terminal 26 amino acids, which includes a signal sequence for attachment of the GPI anchor was PCR amplified using a forward primer containing an XhoI site (underlined) (5′eccectcgagtggacaatcacantggg3′; SEQ ID NO: 1) and a reverse primer with an EcoRV site (underlined) (5′taaggagatatcttaattttcaagetgttcgtia3′; SEQ ID NO: 3). The reverse primer introduced a stop codon following Asparagine 77 resulting in a sequence that encodes a soluble form of human CD59. The XhoIIEcoRV digested PCR product was cloned into XhoIIEcoRV digested pShCAG and the resulting plasmid pShCAGsCD59 was used to produce the adenovirus AdCAGsCD59 as described herein. Thus, the GPI signal was removed by recombinant methods to obtain a construct that expresses a soluble, secreted version, and analyses were performed to test whether the secreted version might be useful as a therapeutic agent, as it would more readily spread through the retina and confer protection from MAC deposition for cells that were not directly contacted and transduced with a gene transfer vector.
To evaluate this construct, cells were prepared that carry the soluble CD59 construct, either expressed on a plasmid or on an adenovirus, and were grown and expression in medium was determined.
To determine the effect of expression CD59 having no GPI signal, engineered so that soluble secreted CD59 protein spreads extracellularly and confers protection against MAC deposition on cells that were not directly transduced with a gene transfer vector, the soluble CD59 protein was expressed in cultured RPE cells and conditioned media from those RPE cells used to confer protection against MAC deposition on hepatocytes. Thus these cells and tissues were prepared for in vivo testing of the soluble secreted CD59 construct as a potential improved therapeutic agent, to determine whether this construct is even more efficient in remediation of MAC deposition than the membrane-bound form.
Examples determined the extent that the soluble secreted CD59 expressing vector protected tissues and cells from cell morphology changes and cell lysis associated with MAC deposition. The ability of secreted CD59 to spread extracellularly through the retina and liver from cells infected with an expressing vector, to prevent MAC deposition on a number of cell types including endothelial cells was tested in a model of wet AMD and a humanized in vivo model of dry AMD respectively.
Results from examples herein indicated potential advantages of the soluble faun of CD59 as a therapeutic agent for macular degeneration compared to the membrane-bound form. Additional possibilities include use of both the membrane-bound form and the soluble forms under different conditions, or in combination.
Example 18: Soluble Human CD59 was Processed and Secreted In VitroAn adenovirus containing an expression cassette for membrane-independent humanCD59 was constructed. The amino acid sequence for the membrane-independent CD59 protein is shown below using one letter amino acid symbols: MGIQGGSVLFGELLVLAVECHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVY NKCWKFEHCNFNDVTIRLRENELTYYCCKI(DLCNFNEQLEN (CD59; SEQ ID NO: 4). The corresponding nucleotide sequence for the membrane-independent CD59 protein is shown in SEQ TT) NO:5. The membrane-independent human CD59 encoded by the vector lacks the C-terminal 26 amino acids encoding the signal sequence for attachment of the GPI anchor. The human CD59 nucleic acid sequence lacking the nucleotides encoding the C-terminal 26 amino acids was amplified by PCR using SEQ ID NO: 1 and SEQ ID NO: 3 as described in Examples herein. Control viruses AdCAGGFP and AdCAGpA were also constructed.
Media obtained from human ARPE-19 cells transfected with either AdCAGsCD59 or AdCAGGFP were mixed with normal human serum (NHS) to a final scrum concentration of 1% (v/v). The media/NHS was then added to mouse Hepa-lcl c7 cells (4.8×105 cells/ml) and incubated at 37° C. with gentle rotary motion. As a control, cells were also contacted with 1% heat-inactivated normal human serum (HI-NHS) in either AdCAGsCD59- or AdCAGGFP-conditioned media. Hepa-1 cic7 cells were analyzed one hour after incubation for cell lysis by flow cytometry measurement of propidium iodide uptake.
Greater cell lysis was observed in Hepa-lcl c7 cells treated with NHS and AdCAGGFP-conditioned media (79.87+7.54%) compared to cell lysis in cells treated with NHS and AdCAGsCD59-conditioned media (52.66±4.43%;
To determine whether ocular delivery of an adenovirus into an eye of a mouse would affect the amount of choroidal neovascularization (CNV) induced by laser bum, vectors were designed to test whether the presence of the vector altered the CNV model system. Vector AdCAGpA was mixed in a 1:10 ratio with vector AdCAGGFP to localize the injection site, and was injected into the subretinal space of six week-old C57B16/J mice. After 72 hours from injection with the vector mixture AdCAGpA/ADCAGGFP, mice were subjected to laser burn treatment. Laser burn treatment involved dilating each pupil with a drop of each of 2.5% phenylephrine hydrochloride and 1% Tropicamidc (Bausch and Lomb; Madison, N.J.). A drop of 2.5% Hypromellose/Gonak (Akorn Inc.; Somerset, N.J.) was then applied to the cornea and the back of the eye, which was viewed with a microscope and a coverslip held on the cornea. Three laser spots (75 um) were made on each eye using an argon laser (532 nm; 100 milliseconds; 150 mW). Control animals not injected were also subject to laser bum treatment. The subjects were then kept for an additional seven days to allow CNV to develop in the eyes. Eyes were harvested, cornea, lens, and retina removed, and RPE/choroid flatmounts were incubated for 30 minutes in 2.5 mg/ml BSA in PBS and then were stained for one hour at 37° C. with a FITC-conjugated GSL I, isolectin B4, a lectin specific for endothelial cells (Vector Labs; Burlingame, C A).
A representative micrograph of a CNV spot for eyes injected with AdCAGpA/AdCAGGFP and eyes from mice that were not injected, respectively are shown in
Each vector AdCAGpA and AdCAGsCD59 was mixed in a 1:10 ratio with vector AdCAGGFP, and the resulting mixtures were injected (2.4×107 total particles of adenovirus) into murine subretinal space. Eyes were treated with laser to induce burns as described herein. Seven days after laser treatment, RPE/choroid flatmounts were stained with FITC-conjugated GSL I, isolectin B4. Representative micrographs of the region of adenovirus transduction relative to the sites of laser burn for each of the eyes injected with AdCAGpA and AdCAGsCD59 respectively are shown in
CNV spots from both groups of mice were imaged by confocal microscopy and the size of each CNV spot measured. Representative micrographs of a CNV spot from an eyecup injected with AdCAGpA and a CNV spot from an eyecup injected with AdCAGsCD59 respectively are shown in
A significant (61.0±11.6%, p<0.0001) reduction in size of the CNV spot was observed for eyecups in mice injected with AdCAGsCD59 compared to eyecups in mice injected with AdCAGpA. These data show that delivery of AdCAGsCD59 to murine RPE conferred significant protection against laser-induced CNV.
Example 22: AdCAGsCD59 Transduction of Murine RPE Reduced MAC Deposition at the Site of CNVRPE/choroid flatmounts were injected with either AdCAGpA or AdCAGsCD59 and subjected to laser burn as described herein. The injected eyecups were then stained with a 1:200 dilution of anti-mouse C9 antibody for 2.5 hours at room temperature and then 1:400 dilution of CY3-conjugated goat anti-rabbit antibody at room temperature for one hour.
MAC staining in the RPE/choroid flatmounts injected with AdCAGpA was observed to extend beyond the region of GSL I staining (
Adenovirus-associated virus (AAV) serotype 2, which efficiently infects retinal ganglion cells after intravitreal delivery to mouse eye, was used to prepare a vector for delivery of sCD59. See
The AAV vector construct expressing membrane-independent human CD59 was injected (8×109 genome copies) into the vitreous of the eyes of six to eight week old mice. Control mice were injected with an AAV-2 vector containing a GFP transgene. The RPE of injected animals were subjected to laser burn treatment between 12 and 19 days post-injection. Eyes were harvested seven days after laser burn treatment.
A significant reduction in CNV size was observed in eyecups in mice intravitreally injected with AAVCAGsCD59 (56.0±18.1%; p<0.01) compared to the eyecups in mice intravitreally injected with AAVCAGGFP.
To test whether human complement would be activated by murine endothelial cells, methods herein were used to develop an ex-vivo human MAC (hMAC) deposition. Explants of murine aortas were incubated with either NHS alone or with NHS and generic anti-mouse (GAM) antibody. Each aorta was stained with an antibody specific for human MAC (hMAC) to detect MAC complex deposition on the tissues (
Low levels of MAC staining were observed along the luminal surface of aortas incubated with either NHS alone or with NHS in combination with GAM. Membrane staining was observed on individual cells (
The aortas incubated with anti-mPECAM antibody prior to incubation with NHS showed more robust and homogeneous MAC staining compared to aortas incubated with GAM antibody and NHS (compare
Anti-mPECAM1 antibody, an endothelial cell-specific antibody, is used in methods described herein for activating human complement on mouse endothelial cells. Anti-mPECAM1 was delivered in vivo to C57B16/J mice using intra-cardial injection. Four hours after the animals were injected intra-cardially, tissues were stained with a CY3-conjugated goat anti-hamster antibody.
Anti-mPECAM1 antibody was detected on endothelial cells in the following tissues: the liver, the retina, the choroid, and the aorta (
Detection of the anti-mPECAM1 antibody on the endothelial cells of the choriocapillaris, capillaries forming the inner vascular layer of the choroid of the eye, may be blocked by the presence of choroidal pigments in these tissues. To investigate detection of antibody binding to endothelial cells of the choriocapillaris, anti-mPECAM1 antibody and GAM antibody were each intra-cardially injected into BALB/C mice. Animals were sacrificed and choroidal/RPE flatmounts were removed and stained with CY3-conjugated goat anti-hamster antibody (
Data show extensive binding of anti-mPECAM1 antibody along the choriocapillaris. Intra-cardial injection of GAM resulted in high levels of non-specific binding to the endothelium in the liver, retina, and choroid (
Intra-cardial injection of anti-mPECAM1 antibody was observed herein to be detectable in tissues of animals. Mice were injected intra-cardially with anti-mPECAM antibody and were then perfused either with NHS or with HI-NHS. Animals were sacrificed and tissues including the liver, choroid, and retina were stained for hMAC deposition fifteen minutes after the serum infusion.
The MAC staining images of animal liver sections infused with anti-mPECAM1 and NHS were observed to be similar to the images of animal liver sections incubated with mPECAM1 and stained with CY3-conjugated goat anti-hamster antibody. (Compare
These data show a 3.77-fold increase in MAC deposition in mice intra-cardially injected with anti-mPECAM antibody and perfused with NHS compared to mice perfused with HI-NHS. No MAC deposition was detected in other tissues of mice perfused either with NHS or with control HI-NHS.
Example 27: Intraperitoneal Injection of an Adenovirus Expressing Membrane-Independent Human CD59 Reduced MAC Deposition on Liver Endothelial CellsAlternative routes of administering the viral constructs expressing human membrane-independent CD59 and controls were investigated. intraperitoneal injection of an adenovirus expressing GFP (AdCAGGFP) resulted in GFP expression mainly along the peritoneal membrane of the liver and also expression of GFP by cells within the liver (
MAC staining was observed in the liver sections from mice injected with AdCAGGFP (
Administration of adenovirus alone has been shown to activate complement in animals (Appledorn, D. M. et al. 2008 Gene Ther. 15(24): 1606-1617). The anti-MAC antibody used in examples detected both mouse and human MAC. Whether MAC deposition observed resulted from human complement activation between serum and non-self tissues, or mouse complement activation due to the administration of an adenovirus, was therefore determined.
Mice were injected intraperitoneally with AdCAGGFP and were intra-cardially injected after seven days with anti-mPECAM1. Animals were then perfused with PBS−4−− (0.15 mM NaCI, 0.9 mM CaCl2, 0.5 mM MgCl2). Liver sections of the mice perfused with PBS' were observed to not stain positively for MAC.
Thus, the MAC deposition detected in mice injected with adenovirus and perfused with NHS was observed to be a result of human complement activation and not activation of mouse complement by the injection of adenovirus.
Example 28: Delivery of AdCAGsCD59 Protected Endothelial Dells of Blood Vessels in the Liver from MAC DepositionProtection by sCD59 was investigated in endothelial cells of the blood vessels for MAC deposition that was observed on endothelial cells of both the sinusoids and blood vessels. Staining along larger vessel luminal surface in the sCD59 group was observed to be discontinuous and less intense, compared to the staining observed for vessel luminal surface for mice injected with adenovirus expressing GFP (
The vessels of livers of mice injected with AdCAGsCD59 were observed to have reduced average MAC staining compared to the livers of mice injected with AdCAGGFP. The average intensity per endothelial cell area in the livers of mice injected with AdCAGsCD59 was 251.27 IU/vtm2, and for livers of mice injected with AdCAGGFP was 428.95 IU/pm2. MAC staining in the vascular endothelial cells of the liver was significantly reduced (41.4%; p<0.001) by injected mice with AdCAGsCD59 compared to mice injected with AdGAGGFP (
Claims
1-102. (canceled)
103. A pharmaceutical composition for use in treating a macular degeneration in a human subject, the pharmaceutical composition comprising a membrane-independent CD59 protein and a pharmaceutically acceptable buffer, wherein the pharmaceutical composition is sufficiently pure for administration to a human subject.
104. The pharmaceutical composition of claim 103, wherein the membrane-independent CD59 protein lacks a glycosyl phosphatidyl inositol (GPI) anchoring domain.
105. The pharmaceutical composition of claim 103, wherein the membrane independent CD59 protein comprises about 90% identity to SEQ ID NO: 5.
106. The pharmaceutical composition of claim 103, wherein the membrane independent CD59 protein comprises about 95% identity to SEQ ID NO: 5.
107. The pharmaceutical composition of claim 103, wherein the membrane independent CD59 protein comprises about 99% identity to SEQ ID NO: 5.
108. The pharmaceutical composition of claim 103, wherein the membrane independent CD59 protein is identical to SEQ ID NO: 5.
109. The pharmaceutical composition of claim 103, wherein the membrane-independent CD59 protein does not further encode a fusion to a peptide or protein domain that binds to a cell membrane or membrane associated entity.
110. The pharmaceutical composition of claim 103, formulated for a route of injection delivery that is at least one selected from the group of intra-ocular, subconjunctival, and subtenon.
111. The pharmaceutical composition according to claim 103, formulated as an eye drop or an ointment.
112. The pharmaceutical composition of claim 1, further comprising at least one agent selected from the group consisting of: an anti-tumor, an antiviral, an antibacterial, an anti-mycobacterial, an anti-fungal, an anti-proliferative, and an anti-apoptotic.
113. A kit for treating a macular degeneration in a subject comprising:
- a pharmaceutical composition comprising a membrane-independent CD59 protein, wherein the composition is sufficiently pure for administration to the subject;
- instructions for use; and
- a container.
114. The kit of claim 113, wherein the membrane-independent CD59 protein lacks a glycosyl phosphatidyl inositol (GPI) anchoring domain.
115. The kit of claim 113, wherein the membrane independent CD59 protein comprises about 90% identity to SEQ ID NO: 5.
116. The kit of claim 113, wherein the membrane independent CD59 protein comprises about 95% identity to SEQ ID NO: 5.
117. The kit of claim 113, wherein the membrane independent CD59 protein comprises about 99% identity to SEQ ID NO: 5.
118. The kit of claim 113, wherein the membrane independent CD59 protein is identical to SEQ ID NO: 5.
119. The kit of claim 113, wherein the membrane-independent CD59 protein does not further encode a fusion to a peptide or protein domain that binds to a cell membrane or membrane associated entity.
120. The kit of claim 113, wherein the pharmaceutical composition is formulated for a route of injection delivery that is at least one selected from the group of intra-ocular, subconjunctival, and subtenon.
121. The kit of claim 113, wherein the pharmaceutical composition is formulated as an eye drop or an ointment.
122. The kit of claim 113, wherein the kit further comprises at least one agent selected from the group consisting of: an anti-tumor, an antiviral, an antibacterial, an anti-mycobacterial, an anti-fungal, an anti-proliferative, and an anti-apoptotic.
Type: Application
Filed: Jun 14, 2019
Publication Date: Jun 25, 2020
Inventors: Rajendra Kumar-Singh (Boston, MA), Siobhan M. Cashman (Boston, MA), Kasmir Ramo (Cambridge, MA)
Application Number: 16/442,163