INHIBITORS OF IGFBP3 BINDING TO TMEM219 FOR TREATMENT OF INTESTINAL DISEASES
The present invention relates to an inhibitor of IGFBP3 binding to TMEM219 and uses thereof for the treatment and/or prevention of an intestinal disease in a subject, in particular the treatment and/or prevention of diabetic enteropathy or inflammatory bowel disease.
This application is a continuation of U.S. application Ser. No. 15/579,573, filed Dec. 4, 2017, which is the National Stage of International Application No. PCT/EP2016/062790, filed Jun. 6, 2016, which claims the right of priority to European Application EP 15170679.3, filed Jun. 4, 2015, each of which is herein incorporated by reference in its entirety.
SEQUENCE LISTINGThe instant application contains a Sequence Listing which has been submitted via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Apr. 21, 2020, is named 45973US sequencelisting.txt, and is 8,192 bytes in size.
TECHNICAL FIELDThe present invention relates to an inhibitor of IGFBP3 and uses thereof for the treatment and/or prevention of an intestinal disease, in particular of diabetic enteropathy or inflammatory bowel disease.
The present invention also relates to IGFBP3 and uses thereof for the diagnosis, prognosis or an intestinal disease, in particular of diabetic enteropathy or inflammatory bowel disease.
BACKGROUND ARTGastrointestinal disorders, consisting of gastroparesis, abdominal distension, irritable bowel syndrome and fecal incontinence, are common in individuals with type 1 diabetes (T1D)(1993). Indeed up to 80% of individuals with long-standing T1D, who are generally affected by several diabetic complications including end stage renal disease (ESRD) (1993; Atkinson et al., 2013; Fiorina et al., 2001), show intestinal symptoms. The presence of these gastrointestinal symptoms, known as diabetic enteropathy (DE), significantly reduces the quality of life (1993; Atkinson et al., 2013; Camilleri, 2007; Talley et al., 2001) and has a largely unknown pathogenesis (Feldman and Schiller, 1983). Preclinical studies showed significant derangement of the intestinal mucosa morphology in diabetic rodents (Domenech et al., 2011; Zhao et al., 2003), suggesting that in T1D intestinal homeostasis may be altered; however, little data are available in humans. The intestinal epithelium is maintained by intestinal stem cells and their niche, which respond to physiological stress and to environmental injury (Barker, 2014; Medema and Vermeulen, 2011). Colonic stem cells (CoSCs), located at the crypt base of the large intestine and expressing the ephrin B receptor 2 (EphB2), leucine-rich repeat containing G protein-coupled receptor 5 (LGR5), h-TERT and aldehyde dehydrogenase (Aldh), among other markers (Carlone and Breault, 2012; Carpentino et al., 2009; Jung et al., 2011; Sato and Clevers, 2013), constitute with the local microenvironment the CoSC niche (van der Flier and Clevers, 2009; Zeki et al., 2011). Recent studies have established conditions that recapitulate many features of intestinal homeostasis and generate normal self-renewing large crypt organoids in vitro, or so-called “mini-guts” (Sato and Clevers, 2013). Whether systemic factors, such as circulating hormones, serve to control the CoSCs remains to be established (Stange and Clevers, 2013).
The treatment of gastrointestinal disorders, in particular diabetic enteropathy, includes symptomatic drugs and reliever medications for diarrhea, abdominal pain, constipation, and dyspepsia. Up to date there is no specific treatment available for diabetic enteropathy. The diagnosis of gastrointestinal disorders, in particular diabetic enteropathy includes colon endoscopy, gastric endoscopy, anorectal manometry, esophageal manometry and analysis of fecal samples, evaluation of peripheral cancer markers (i.e. CEA, Ca 19.9, alpha-fetoprotein, Ca125) and of celiac markers. None of the aforementioned method is capable of providing a certain diagnosis of diabetic enteropathy.
WO 2011133886 and WO2007024715 discloses a therapeutic composite in the form of a IGFBP3 binding antibody.
WO0187238 relates to an anticancer pharmaceutical composition comprising a therapeutically effective TMEM219, in particular for the treatment of colon cancer.
WO 2014089262 discloses the use of IGFBP3 as a marker of diagnosis of chronic inflammation (obesity) disorders (in particular, inflammatory bowel disease such as UC and Crohn's disease and colon cancer).
U.S. Pat. No. 6,066,464 relates to an immunoassay for the detection of IGFBP3 on a solid support that is paper.
WO2013152989 relates to the use of IGFBP3 as a biomarker of colorectal cancer.
WO0153837 discloses a method of monitoring or diagnosing disease conditions, that involve measuring a combination of tumor markers and at least one component of the IGF axis. IGFBP3 is proposed as a marker of colon tumors.
Therefore there is the need for alternative treatments and diagnosis methods of gastrointestinal disorders, in particular diabetic enteropathy.
SUMMARY OF THE INVENTIONWhether systemic factors serve to control the homeostasis of colonic epithelium and of colonic stem cells (CoSCs) remains unclear. The inventors hypothesize that a circulating “hormonal” dyad controls CoSCs and is disrupted in long-standing type 1 diabetes (T1D) leading to diabetic enteropathy (DE). Individuals with long-standing T1D exhibited abnormalities of intestinal mucosa and CoSCs, and failure to generate in vitro mini-guts. Serum proteomic profiling revealed altered circulating levels of insulin-like growth factor 1 (IGF-I) and its binding protein-3 (IGFBP3) in 30 long-standing T1D individuals, with evidences of an increased hyperglycemia-mediated IGFBP3hepatic release. IGFBP3 prevented mini-gut growth in vitro via a TMEM219-dependent/caspase-mediated IGF-I-independent effect and disrupted CoSCs in preclinical models in vivo. The restoration of normoglycemia in long-standing T1D, with kidney-pancreas transplantation, and the treatment with an ecto-TMEM219 recombinant protein in diabetic mice, re-established CoSCs by restoring appropriate IGF-I/IGFBP3 circulating levels. The peripheral IGF-I/IGFBP3 dyad controls CoSCs and is dysfunctional in DE.
Here the inventors demonstrate that individuals with long-standing T1D and DE have altered CoSCs and show increased levels ofIGFBP3. Administration of IGFBP3 alters CoSC regenerative properties and mucosa morphology in vitro and in vivo, in a preclinical model of DE, by quenching circulating IGF-I and by exerting a TMEM219-dependent/caspase-mediated toxic effect on CoSCs.
Further, altered IGFBP3/IGF-I ratio was found in patients with inflammatory bowel disease. A new ecto-TMEM219 recombinant protein, based on the extracellular domain of the IGFBP3 receptor (TMEM219) was generated. ecto-TMEM219 quenches peripheral IGFBP3 and prevents its binding to IGFBP3 receptor, TMEM219. Then, targeting IGFBP3 with such ecto-TMEM219 recombinant protein, expressed on CoSCs, abrogates IGFBP3 deleterious effects in vitro and in vivo.
Intestinal disorders include diabetic enteropathy, inflammatory bowel diseases, irritable bowel disease and celiac disease.
Symptoms reported in individuals with diabetic enteropathy are similar to those reported in other intestinal disorders, therefore the role of intestinal stem cells (ISCs) in various colorectal diseases has been investigated in a number of studies (Table I-A below).
Alterations in ISC regulation and in crypt and epithelial self-renewal properties have been described in IBD10, in colon pre-cancerous conditions11, and in colorectal cancer4. Recently, it has also been suggested that ISCs may be depleted in active celiac disease (CD), thus leading to impaired regeneration of the intestinal epithelial compartment, which may account for the disappearance of villin. Considering that IGFBP3 has been demonstrated to target the colonic stem cells (CoSCs), a particular subset of ISCs located in the colonic crypts, through its binding to TMEM219, the IGFBP3 receptor, thus mediating the onset of diabetic enteropathy, it is argued that this detrimental effect may be exerted also on CoSCs in other intestinal disorders, as the aforementioned ones. Therefore, the inhibition of the TMEM219/IGFBP3 axis may represent a strategy that preserves CoSCs and ISCs from the IGFBP3-mediated detrimental effects in all intestinal disorders that may originate from a dysregulation of ISCs or CoSCs.
Therefore the present invention provides an inhibitor of IGFBP3 for use in the treatment and/or prevention of an intestinal disorder.
Preferably the inhibitor is an inhibitor of the IGFBP3/TMEM219 axis.
Preferably said inhibitor inhibits or blocks the interaction of IGFBP3 with its receptor TMEM219 (also named IGFBP3-receptor) or wherein said inhibitor inhibits or blocks the interaction of IGFBP3 with IGF-I or wherein said inhibitor inhibits or blocks IGFBP3 function.
Preferably said inhibitor is selected from the group consisting of:
-
- a) a polypeptide;
- b) a polynucleotide coding for said polypeptide or a polynucleotide able to inhibit or block the interaction of IGFBP3 with its receptor TMEM219 or able to inhibit or block the interaction of IGFBP3 with GF1 or able to inhibit or block IGFBP3 expression and/or function;
- c) a vector comprising or expressing said polynucleotide;
- d) a host cell genetically engineered expressing said polypeptide or said polynucleotide;
- e) a small molecule;
- f) a peptide, a protein, an antibody, an antisense oligonucleotide, a siRNA, antisense expression vector or recombinant virus or any other agent able to inhibit or block the interaction of IGFBP3 with its receptor TMEM219 or able to inhibit or block the interaction of IGFBP3 with GF1 or able to inhibit or block IGFBP3 expression and/or function.
Still preferably said inhibitor is the receptor TMEM219 or a fragment thereof. Preferably the fragment of TMEM219 is a fragment of the extracellular domain of TMEM219.
In a preferred embodiment the inhibitor is ecto-TMEM219.
The inhibitor may be a fusion protein comprising IGFBP3.
In a preferred embodiment the inhibitor is an antibody, preferably an IGFBP3-blocking antibody, preferably a TMEM219-blocking antibody, preferably an IGF-I-blocking antibody.
In a preferred embodiment the intestinal disorder is selected from the group consisting of: malabsorption syndromes, celiac disease, irritable bowel syndrome, inflammatory bowel disease, cachexia, diabetic enteropathy.
Preferably the intestinal disorder is diabetic enteropathy or inflammatory bowel disease (ulcerative colitis and Crohn's disease). Preferably the intestinal disorder is celiac disease.
Inflammatory bowel disease (IBD) involves chronic inflammation of all or part of the digestive tract. IBD primarily includes ulcerative colitis and Crohn's disease. Both usually involve severe diarrhea, pain, fatigue and weight loss. IBD can be debilitating and sometimes leads to life threatening complications. Ulcerative colitis is an inflammatory bowel disease that causes long lasting inflammation and sores (ulcers) in the innermost lining of the large intestine (colon) and rectum. Crohn's disease is an IBD that causes inflammation of the lining of the digestive tract. In Crohn's disease, inflammation often spreads deep into affected tissues. The inflammation can involve different areas of the digestive tract—the large intestine, small intestine or both.
Celiac disease, also known as gluten-sensitive enteropathy, is a chronic disease of the upper digestive caused by an immunologically mediated, inflammatory reaction to ingested gliadin.
Gliadin is a component of gluten, a protein found in grains such as wheat, rye, and barley. Such inflammatory response damages the intestinal mucosa resulting in maldigestion and malabsorption.
In a further aspect the invention provides a pharmaceutical composition for use in the treatment and/or prevention of an intestinal disorder comprising the inhibitor as defined above and pharmaceutically acceptable carriers.
In a further aspect the invention provides a method for the diagnosis of an intestinal disorder in a subject comprising:
-
- a) measuring the amount of the protein IGFBP3 or the amount of the polynucleotide coding for said protein in a biological sample obtained from the subject;
- b) comparing the measured quantity of the protein IGFBP3 or measured quantity of the polynucleotide coding for said protein to a control amount, wherein if the measured quantity is higher than the control amount, the subject is diagnosed with the intestinal disorder.
Preferably the quantity of IGFBP3 is measured by an antibody.
Preferably the biological sample is selected from the group consisting of: serum, urine, cell culture supernatant.
Still preferably the intestinal disorder is selected from the group consisting of: malabsorption syndromes, irritable bowel disease, inflammatory bowel disease, cachexia, diabetic enteropathy.
Yet preferably the intestinal disorder is diabetic enteropathy.
In a further aspect the invention provides a kit for the diagnosis of an intestinal disorder comprising means to measure the amount of the protein IGFBP3 and/or means to measure the amount of the polynucleotide coding for said protein and optionally, control means. The above diagnosis method may also comprise a step of treating the subject, in particular the treatment may be an inhibitor of IGFBP3 as defined in the present invention or an existing treatment for an intestinal disorder such as anti-inflammatory agents (e.g. aminosalicyl-derivatives such as mesalazin, sulfasalazine), corticosteroids, immunosuppressive treatments (azothioprine, mercaptopurine, methotrexate, cyclosporine, micophenolate mofetil, natalizumab, vedolizumab), TNF-alpha blockers (infliximab, adalimumab, certolizumab, golimumab), antibiotics (e.g. metronidazole and ciprofloxacin), probiotics, integrin alpha inhibitors.
In the present invention an intestinal disorder comprises gastro-intestinal disorder, malabsorption syndromes, diabetic enteropathy, cachexia, celiac disease, irritable bowel syndromes, and inflammatory bowel diseases. In the present invention an intestinal disorder does not include colorectal cancers.
In the present invention “inhibits or blocks IGFBP3 function” means quenching circulating IGFBP3 and preventing its binding to IGFBP3 receptor, TMEM219, in order to halt IGFBP3 proapoptotic effect on CoSCs and colonic crypts. Such inhibition or blocking may be achieved by a fusion protein comprising IGFBP3. The expression of IGFBP3 may be measured by means of RT-PCR on tissues and cells, Western blot on tissues and cells, Immunohistochemistry on tissues.
Levels of IGFBP3 in biological fluids can be measured by immune-targeted assays and proteomic analysis.
The function of IGFBP3 may be measured by means of detecting Caspases 8 and 9 expression on target cells using RT-PCR, microarrays, by co-culturing target cells/structures with Pan Caspase inhibitor, Caspases 8 and 9 inhibitors and measuring live cells/structures.
In the present invention “inhibits or blocks the interaction of IGFBP3 with IGF-I” means removing free IGFBP3 from the circulation in order to prevent its binding to free IGF-I.
The interaction of IGFBP3 with IGF-I may be measured by means of evaluating IGF-I free levels in the circulation and/or IGFBP3 levels in the circulation.
In the present invention “inhibit or block the interaction of IGFBP3 with its receptor TMEM219” means quenching circulating IGFBP3 and preventing its binding to TMEM219 receptor expressed on CoSCs. The IGFBP3-TMEM219 binding could be prevented also by the use of an IGFBP3-blocking antibody. In addition, a TMEM219 blocking antibody could bind TMEM219 receptor thus rendering the receptor unavailable when IGFBP3 comes from the circulation.
In the present invention inhibiting the IGFBP3/TMEM219 axis means blocking IGFBP3 binding to TMEM219, for instance by quenching IGFBP3 from the circulation, it also means blocking the IGFBP3-binding site of TMEM219, blocking IGFBP3 binding site on TMEM219. It further means inhibiting TMEM219 function and/or expression and/or signaling, this may be achieved for instance by silencing TMEM219 expression, in particular with SiRNA or oligonucleotides. It also means inhibiting the function and/or expression of IGFBP3. According to the invention, an inhibitor of IGFBP3 binding to TMEM219 can be one of the following molecules:
-
- Soluble Ecto-TMEM219 (extracellular portion of TMEM219) which neutralizes circulating IGFBP3;
- Fusion protein TMEM219-Ig, an Fc-based fusion protein composed of an immunoglobulin Fc domain that is directly linked to TMEM219 peptide or to its extracellular portion, which quenches circulating IGFBP3 and prevents its binding to TMEM219 expressed on beta cells;
- Anti-IGFBP3 antibody that selectively blocks the TMEM219-binding site;
- Anti-TMEM219 antibody, which occupies the IGFBP3 binding site of TMEM219 receptor thus preventing IGFBP3 binding (having antagonistic activity with respect to IGFBP3)
- Oligonucleotides complementary to IGFBP3 mRNA
The inhibitor of the invention may be the receptor TMEM219 (MGNCQAGHNLHLCLAHHPPLVCATLILLLLGLSGLGLGSFLLTHRTGLRSPDIPQDWVS FLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGL KGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEEC VSVWSHEGLVLTKLLTSEELALCGSRLLVLGSFLLLFCGLLCCVTAMCFHPRRESHWSR TRL, SEQ ID NO: 1) or a fragment thereof.
In particular the fragment of TMEM219 is designed such as to block/prevent IGFBP3 access and/or binding to TMEM219, it has a smaller molecular weight, it contains five cysteines that form disulfide bridges and a globular structure. Preferably the fragment is at least 50 amino acid long, preferably 100 amino acid long, still preferably 120 amino acid long, yet preferably 150 amino acid long, preferably at least 160 amino acid long.
Ina preferred embodiment the fragment is at least 162, 165, 170, 175, 180, 185, 190, 195, 200, 205, 210, 215, 220, 225, 230, 235 amino acid long. Preferably the fragment has at least 65% identity with the sequence of TMEM219, preferably at least 70%, 75%, 80%, 85%, 90%, 95% or 99% identity with the sequence of TMEM219.
Preferably the fragment of TMEM219 is a fragment of an extracellular domain of TMEM219, in particular the fragment comprises the sequence:
Preferably the fragment of TMEM219 is an extracellular domain of TMEM219, in particular the fragment comprises the sequence:
Preferably the fragment of TMEM219 consists of:
Preferably the fragment of TMEM219 consists of:
In the present invention TMEM219 is preferably eukaryote TMEM219, preferably a mammal TMEM219, still preferably human TMEM219.
The interaction of IGFBP3 with TMEM219 may be measured by means of indirect assessment of the effects of IGFBP3 on target cells (increased Caspase 8 and 9 expression with RT-PCR), direct assessment of IGFBP3-IGFBP3-receptor (TMEM219) binding with Liquid or Solid Phase Ligand Binding Assays (i.e. immunoprecipitation, RT-PCR, immunoassays) and Non-radioactive Ligand Binding Assays.
In the present invention “long-standing T1D” means a history of type 1 diabetes longer than 15 years associated with the development of diabetic complications.
In a preferred aspect of the invention, the inhibitor is an antibody or synthetic or recombinant derivative thereof. Said antibody is preferably a monoclonal or polyclonal antibody, or synthetic or recombinant derivatives thereof, more preferably said antibody being a humanized monoclonal antibody.
Preferably, said polynucleotide is a RNA or DNA, preferably a siRNA, a shRNA, a microRNA or an antisense oligonucleotide.
In a preferred embodiment, the above vector is an expression vector selected from the group consisting of: plasmids, viral particles and phages.
Preferably, said host cell is selected from the group consisting of: bacterial cells, fungal cells, insect cells, animal cells, plant cells, preferably being an animal cell, more preferably a human cell.
In a preferred embodiment, the inhibitor as above defined (a) is combined with at least one therapeutic agent (b) to define a combination or combined preparation. The therapeutic agent may be an anti-diabetic agent, a pain reliever, medication for diarrhea or any other treatment for an intestinal disorder in particular diabetic enteropathy.
Examples of therapeutic agent are: insulin therapy, in any form; pramlintide; angiotensin-converting enzyme inhibitors or angiotensin II receptor blockers (ARBs); aspirin, anticoagulation and platelet anti-aggregation agents; cholesterol-lowering drugs; other blood pressure lowering agents; oral anti-diabetic agents like metformin, sulfonylureas (glyburide, glipizide and glimepiride, meglitinides (repaglinide and nateglinide), thiazolidinediones (Rosiglitazone and pioglitazone), DPP-4 inhibitors (sitagliptin, saxagliptin and linagliptin), GLP-1 receptor agonists (Exenatide and liraglutide), SGLT2 inhibitors (e.g. canagliflozin and dapagliflozin); anti-inflammatory agents (e.g. aminosalicyl-derivatives such as mesalazin, sulfasalazine); corticosteroids; immunosuppressive treatments (azothioprine, mercaptopurine, methotrexate, cyclosporine, micophenolate mofetil) integrin inhibitors (natalizumab, vedolizumab); TNF-alpha blockers (infliximab, adalimumab, certolizumab, golimumab), antibiotics (e.g. metronidazole and ciprofloxacin); probiotics.
The terms “combination” and “combined preparation” as used herein also define a “kit of parts” in the sense that the combination partners (a) and (b) as defined above can be dosed independently or by use of different fixed combinations with distinguished amounts of the combination partners (a) and (b), i.e. simultaneously or at different time points. The parts of the kit of parts can then, e.g., be administered simultaneously or chronologically staggered, that is at different time points and with equal or different time intervals for any part of the kit of parts. The ratio of the total amounts of the combination partner (a) to the combination partner (b) to be administered in the combined preparation can be varied, e.g. in order to cope with the needs of a patient sub-population to be treated or the needs of the single.
The combination therapy may result in unexpected improvement in the treatment of intestinal diseases. When administered simultaneously, sequentially or separately, the inhibitor and the other therapeutic agent may interact in a synergistic manner to reduce intestinal disease. This unexpected synergy allows a reduction in the dose required of each compound, leading to a reduction in the side effects and enhancement of the clinical effectiveness of the compounds and treatment.
Determining a synergistic interaction between one or more components, the optimum range for the effect and absolute dose ranges of each component for the effect may be definitively measured by administration of the components over different w/w ratio ranges and doses to patients in need of treatment. For humans, the complexity and cost of carrying out clinical studies on patients renders impractical the use of this form of testing as a primary model for synergy. However, the observation of synergy in one species can be predictive of the effect in other species and animal models exist, as described herein, to measure a synergistic effect and the results of such studies can also be used to predict effective dose and plasma concentration ratio ranges and the absolute doses and plasma concentrations required in other species by the application of pharmacokinetic/pharmacodynamic methods. Established correlations between intestinal disease models and effects seen in man suggest that synergy in animals may be demonstrated in the models as described in the Examples below.
The above pharmaceutical compositions are preferably for systemic, oral, locally, preferably rectally, or topical administration.
Control means can be used to compare the amount or the increase of amount of the compound as above defined to a proper control. The proper control may be obtained for example, with reference to known standard, either from a normal subject or from normal population.
The means to measure the amount of at least one compound as above defined are preferably at least one antibody, functional analogous or derivatives thereof. Said antibody, functional analogous or derivatives thereof are specific for said compound.
In a preferred embodiment, the kit of the invention comprises:
-
- a solid phase adhered antibody specific for said compound;
- detection means of the ligand specific-biomarker complex.
The kits according to the invention can further comprise customary auxiliaries, such as buffers, carriers, markers, etc. and/or instructions for use.
The proper control may be a sample taken from a healthy patient or from a patient affected by a disorder other than intestinal disease.
In the case of a method or a kit for monitoring the progression of the intestinal disease, the progress of the disease is monitored and the proper control may be a sample taken from the same subject at various times or from another patient, and the proper control amount may by the amount of the same protein or polynucleotide measured in a sample taken from the same subject at various times or from another patient.
In the case of a method or a kit for monitoring the efficacy of a therapeutic treatment, the proper control may be a sample taken from the same subject before initiation of the therapy or taken at various times during the course of the therapy and the proper control amount may be the amount of the same protein or polynucleotide measured in a sample taken from the same subject before initiation of the therapy or taken at various times during the course of the therapy.
In the present invention, the expression “measuring the amount” can be intended as measuring the amount or concentration or level of the respective protein and/or mRNA thereof and/or DNA thereof, preferably semi-quantitative or quantitative. Measurement of a protein can be performed directly or indirectly. Direct measurement refers to the amount or concentration measure of the biomarker, based on a signal obtained directly from the protein, and which is directly correlated with the number of protein molecules present in the sample. This signal—which can also be referred to as intensity signal—can be obtained, for example, by measuring an intensity value of a chemical or physical property of the biomarker. Indirect measurements include the measurement obtained from a secondary component (e.g., a different component from the gene expression product) and a biological measurement system (e.g. the measurement of cellular responses, ligands, “tags” or enzymatic reaction products).
The term “amount”, as used in the description refers but is not limited to the absolute or relative amount of proteins and/or mRNA thereof and/or DNA thereof, and any other value or parameter associated with the same or which may result from these. Such values or parameters comprise intensity values of the signal obtained from either physical or chemical properties of the protein, obtained by direct measurement, for example, intensity values in an immunoassay, mass spectroscopy or a nuclear magnetic resonance. Additionally, these values or parameters include those obtained by indirect measurement, for example, any of the measurement systems described herein. Methods of measuring mRNA and DNA in samples are known in the art. To measure nucleic acid levels, the cells in a test sample can be lysed, and the levels of mRNA in the lysates or in RNA purified or semi-purified from lysates can be measured by any variety of methods familiar to those in the art. Such methods include hybridization assays using detectably labeled DNA or RNA probes (i.e., Northern blotting) or quantitative or semi-quantitative RT-PCR methodologies using appropriate oligonucleotide primers. Alternatively, quantitative or semi-quantitative in situ hybridization assays can be carried out using, for example, tissue sections, or unlysed cell suspensions, and detectably labeled (e.g., fluorescent, or enzyme-labeled) DNA or RNA probes. Additional methods for quantifying mRNA include RNA protection assay (RPA), cDNA and oligonucleotide microarrays, representation difference analysis (RDA), differential display, EST sequence analysis, and serial analysis of gene expression (SAGE).
If by comparing the measured amount of the protein IGFBP3 or of the polynucleotide coding for said protein with the amount obtained from a control sample, the amount of said compound in the sample isolated from the subject corresponds to a higher value, the subject may present the disease or go towards an aggravation of said disease.
If by comparing the measured amount of the protein IGFBP3 or of the polynucleotide coding for said protein with the amount obtained from a control sample, the amount of said compound in the sample isolated from the subject corresponds to a similar or lower value, the subject may be not affected by the disease or go toward an amelioration of the disease, respectively.
Alternatively, the expression “detection” or “measuring the amount” is intended as measuring the alteration of the molecule. Said alteration can reflect an increase or a decrease in the amount of the compounds as above defined. An increase of the protein IGFBP3 or of the polynucleotide coding for said protein can be correlated to an aggravation of the disease. A decrease in the protein IGFBP3 or of the polynucleotide coding for said protein can be correlated to an amelioration of the disease or to recovery of the subject.
The expression “protein IGFBP3” or “IGFBP3” or “TMEM219” is intended to include also the corresponding protein encoded from a IGFBP3 or TMEM orthologous or homologous genes, functional mutants, functional derivatives, functional fragments or analogues, isoforms thereof.
The expression “gene IGFBP3” or “IGFBP3” or“gene TMEM219” or “TMEM219” is intended to include also the corresponding orthologous or homologous genes, functional mutants, functional derivatives, functional fragments or analogues, isoforms thereof.
In the present invention “functional mutants” of the protein are mutants that may be generated by mutating one or more amino acids in their sequences and that maintain their activity for the treatment of intestinal disease. Indeed, the protein of the invention, if required, can be modified in vitro and/or in vivo, for example by glycosylation, myristoylation, amidation, carboxylation or phosphorylation, and may be obtained, for example, by synthetic or recombinant techniques known in the art. The protein of the invention “IGFBP3” or “TMEM219” may be modified to increase its bioavailability or half-life by know method in the art. For instance the protein may be conjugated to a polymer, may be pegylated etc.
In the present invention the active ingredients may also be entrapped in microcapsule prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsule and poly-(methylmethacylate) microcapsule, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980).
The formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsule. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethylmethacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and [gamma] ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate, and poly-d(−)-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods. When encapsulated antibodies remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at 37° C., resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S—S bond formation through thio-disulfide interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
In the present invention “functional” is intended for example as “maintaining their activity” e.g. therapeutic treatment of intestinal disease.
The term “analogue” as used herein referring to a protein means a modified peptide wherein one or more amino acid residues of the peptide have been substituted by other amino acid residues and/or wherein one or more amino acid residues have been deleted from the peptide and/or wherein one or more amino acid residues have been deleted from the peptide and or wherein one or more amino acid residues have been added to the peptide. Such addition or deletion of amino acid residues can take place at the N-terminal of the peptide and/or at the C-terminal of the peptide.
The term “derivative” as used herein in relation to a protein means a chemically modified peptide or an analogue thereof, wherein at least one substituent is not present in the unmodified peptide or an analogue thereof, i.e. a peptide which has been covalently modified. Typical modifications are amides, carbohydrates, alkyl groups, acyl groups, esters and the like. As used herein, the term “derivatives” also refers to longer or shorter polypeptides having e.g. a percentage of identity of at least 41%, preferably at least 41.5%, 50%, 54.9%, 60%, 61.2%, 64.1%, 65%, 70% or 75%, more preferably of at least 85%, as an example of at least 90%, and even more preferably of at least 95% with IGFBP3, or with an amino acid sequence of the correspondent region encoded from a IGFBP3 orthologous or homologous gene.
As used herein “fragments” refers to polypeptides having preferably a length of at least 10 amino acids, more preferably at least 15, at least 17 amino acids or at least 20 amino acids, even more preferably at least 25 amino acids or at least 37 or 40 amino acids, and more preferably of at least 50, or 100, or 150 or 200 or 250 or 300 or 350 or 400 or 450 or 500 amino acids. According to the present invention, an “effective amount” of a composition is one that is sufficient to achieve a desired biological effect, in this case an amelioration or the treatment of an intestinal disorder or disease.
It is understood that the effective dosage will be dependent upon the age, sex, health, and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment, and the nature of the effect desired. The provided ranges of effective doses of the inhibitor or molecule of the invention (e.g. from 1 mg/kg to 1000 mg/kg, in particular systemically administered) are not intended to limit the invention and represent preferred dose ranges. However, the preferred dosage can be tailored to the individual subject, as is understood and determinable by one of skill in the art, without undue experimentation.
The administration of oligonucleotides of the present invention may be carried out by known methods, wherein a nucleic acid is introduced into a desired target cell in vitro or in vivo.
An aspect of the present invention comprises a nucleic acid construct comprised within a delivery vehicle. A delivery vehicle is an entity whereby a nucleotide sequence can be transported from at least one media to another. Delivery vehicles may be generally used for expression of the sequences encoded within the nucleic acid construct and/or for the intracellular delivery of the construct. It is within the scope of the present invention that the delivery vehicle may be a vehicle selected from the group of RNA based vehicles, DNA based vehicles/vectors, lipid based vehicles, virally based vehicles and cell based vehicles. Examples of such delivery vehicles include: biodegradable polymer microspheres, lipid based formulations such as liposome carriers, coating the construct onto colloidal gold particles, lipopolysaccharides, polypeptides, polysaccharides, pegylation of viral vehicles.
In one embodiment of the present invention may comprise a virus as a delivery vehicle, where the virus may be selected from: adenoviruses, retroviruses, lentiviruses, adeno-associated viruses, herpesviruses, vaccinia viruses, foamy viruses, cytomegaloviruses, Semliki forest virus, poxviruses, RNA virus vector and DNA virus vector. Such viral vectors are well known in the art. Commonly used gene transfer techniques include calcium phosphate, DEAE-dextran, transfection, electroporation and microinjection and viral methods. Another technique for the introduction of DNA into cells is the use of cationic liposomes. Commercially available cationic lipid formulations are e.g. Tfx 50 (Promega) or Lipofectamin 2000 (Life Technologies).
The compositions of the present invention may be in form of a solution, e.g. an injectable solution, a cream, ointment, tablet, suspension or the like. The composition may be administered in any suitable way, e.g. by injection, particularly by intraocular injection, by oral, topical, nasal, rectal application etc. The carrier may be any suitable pharmaceutical carrier. Preferably, a carrier is used, which is capable of increasing the efficacy of the RNA molecules to enter the target-cells. Suitable examples of such carriers are liposomes, particularly cationic liposomes. The recombinant expression vector of the invention can be any suitable recombinant expression vector, and can be used to transform or transfect any suitable host. Suitable vectors include those designed for propagation and expansion or for expression or both, such as plasmids and viruses. The recombinant expression vectors of the invention can be prepared using standard recombinant DNA techniques. Constructs of expression vectors, which are circular or linear, can be prepared to contain a replication system functional in a prokaryotic or eukaryotic host cell. Replication systems can be derived, e.g., from CoIE1, 2μ plasmid, λ, SV40, bovine papilloma virus, and the like.
Desirably, the recombinant expression vector comprises regulatory sequences, such as transcription and translation initiation and termination codons, which are specific to the type of host (e.g., bacterium, fungus, plant, or animal) into which the vector is to be introduced, as appropriate and taking into consideration whether the vector is DNA- or RNA-based. The recombinant expression vector can include one or more marker genes, which allow for selection of transformed or transfected hosts. Marker genes include biocide resistance, e.g., resistance to antibiotics, heavy metals, etc., complementation in an auxotrophic host to provide prototrophy, and the like. Suitable marker genes for the inventive expression vectors include, for instance, neomycin/G418 resistance genes, hygromycin resistance genes, histidinol resistance genes, tetracycline resistance genes, and ampicillin resistance genes. The recombinant expression vector can comprise a native or normative promoter operably linked to the nucleotide sequence encoding the PCYOX1 inhibitor (including functional portions and functional variants thereof), or to the nucleotide sequence which is complementary to or which hybridizes to the nucleotide sequence encoding the RNA. The selection of promoters, e.g., strong, weak, inducible, tissue-specific and developmental-specific, is within the ordinary skill of the artisan. Similarly, the combining of a nucleotide sequence with a promoter is also within the skill of the artisan. The promoter can be a non-viral promoter or a viral promoter, e.g., a cytomegalovirus (CMV) promoter, an SV40 promoter, an RSV promoter and a promoter found in the long-terminal repeat of the murine stem cell virus.
The inventive recombinant expression vectors can be designed for either transient expression, for stable expression, or for both. Also, the recombinant expression vectors can be made for constitutive expression or for inducible expression. In the above IGFBP3 compositions further materials as well as processing techniques and the like may be set out in Part 5 of Remington's Pharmaceutical Sciences, 20th Edition, 2000, Merck Publishing Company, Easton, Pa., which is incorporated herein by reference.
The compounds of this invention can also be administered in sustained release forms or from sustained release drug delivery systems. A description of representative sustained release materials can also be found in the incorporated materials in Remington's Pharmaceutical Sciences. Furthermore, pharmaceutical formulations can be prepared using a process, which is generally known in the pharmaceutical art.
In the present invention, when the molecule of the invention is administered with another therapeutic agent, it may be administered simultaneously or sequentially.
SEQUENCESAmino Acid Sequence of IGFBP3:
Nucleotide Sequence of IGFBP3:
Homo sapiens insulin-like growth factor binding protein 3 (IGFBP3), RefSeqGene on chromosome 7, NCBI Reference Sequence: NG 011508.1.
mRNA Sequence of IGFBP3:
Homo sapiens insulin-like growth factor binding protein 3 (IGFBP3), transcript variant 1, mRNA, NCBI Reference Sequence: NM 001013398.1.
Amino Acid Sequence of TMEM219:
Nucleotide Sequence of TMEM219:
TMEM219 transmembrane protein 219 [Homo sapiens (human)], Gene ID: 124446.
mRNA Sequence of TMEM219:
Homo sapiens transmembrane protein 219 (TMEM219), transcript variant 1, mRNA, NCBI Reference Sequence: NM_001083613.1
The present invention will be illustrated by means of non-limiting examples in reference to the following figures.
The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
Material and Methods
60 individuals with long-standing T1D (T1D+ESRD) registered on the waiting list for simultaneous pancreas-kidney transplantation (SPK) were enrolled in the study and compared with 20 healthy subjects matched for age and gender (CTRL). Assessment of gastrointestinal symptoms, intestinal motility and intestinal mucosa pathology defined DE. CoSCs were identified on colonic purified crypts based on the expression of CoSC specific markers (flow-cytometry, RT-PCR, Western Blot, transcriptome profiling). CoSCs self-renewal properties were assessed by evaluating the % of in vitro developed mini-guts and by characterizing their expression of cell lineages markers in different conditions (
60 individuals with T1D+ESRD registered on the waiting list for simultaneous pancreas-kidney transplantation (SPK) matched for (age 41 to 43 years old), gender, and duration of T1D (29.4±1.8 years) were enrolled in the study. 20 healthy subjects matched for age and gender (CTRL), with normal renal function and normal glycometabolic parameters, were studied as well. T1D+ESRD subjects were all on intensive insulin treatment at the time of enrollment in the study, while the CTRL group was not being administered any medication. All T1D+ESRD subjects were on the same treatment as antiplatelet therapy (ASA) and anti-hypertension (angiotensin-converting-enzyme inhibitors), while 40 out of 60 received statins when enrolled in the study. Subjects with clear signs of inflammatory bowel diseases as well as celiac disease were not enrolled.
T1D+ESRD individuals were followed up for 8 years (mean follow-up: 8.6±1.1 years) after receiving either SPK (n=30) or K+T1D (n=30) transplantation according to the macroscopic surgical evaluation at the time of transplantation. Individuals taking an oral anticoagulant agent were not included. SPK individuals were all insulin-independent for the entire follow-up period, whereas K+T1D individuals were on intensive subcutaneous insulin therapy. All subjects provided informed consent before study enrollment. Studies not included in the routine clinical follow-up were covered by an appropriate Institutional Review Board approval (Enteropatia-trapianto/01 Secchi/Fiorina).
Transplantation and ImmunosuppressionOrgans for transplantation were obtained from deceased donors through the “North Italia Transplant” organ procurement consortium (NITp, Milan). After induction with ATG (thymoglobulin, IMTIX, SANGSTAT), immunosuppression was maintained using cyclosporine (through levels between 100-250 ng/ml) or FK506 (through levels between 10-15 ng/ml), mycophenolate mofetil (500-2000 mg/day), and methylprednisolone (10 mg/day). Steroids were withdrawn within 3-6 months after transplantation. All patients included in the T1D+ESRD and SPK groups were on anti-platelet therapy (80% ASA and 20% ticlopidine) to prevent graft or fistula thrombosis. Metabolic status, renal function and blood pressure were examined during enrolment and after transplantation every 2 years thereafter. The estimate glomerular filtration rate (eGFR) was calculated using the Modification of Diet in Renal Disease (MDRD) formula (Levey et al., 1999).
The Gastrointestinal Symptom Rating Scale (GSRS)Gastrointestinal symptoms were evaluated by GSRS questionnaire in healthy subjects, in longstanding T1D individuals (T1D+ESRD) and in SPK and K+T1D groups at 2, 4 and 8 years after transplantation. The Gastrointestinal Symptom Rating Scale (GSRS) is a questionnaire consisting of 15 items with a seven-graded Likert scale defined by descriptive anchors (Svedlund et al., 1988). The questionnaire was originally constructed as an interview-based rating scale designed to evaluate a wide range of gastrointestinal symptoms and was later modified to become a self-administered questionnaire. The higher the scores, the more severe the symptoms: the scale ranges from a minimum value of 1 to a maximum value of 7. If an individual's participation in the study is discontinued, the value at the last available observation will be carried forward in the analysis. The items can be grouped into five dimensions previously identified on the basis of a factor analysis: abdominal pain syndrome (three items), reflux syndrome (two items), indigestion syndrome (four items), diarrhea syndrome (three items) and constipation syndrome (three items).
Anorectal ManometryData on anorectal manometry were already available in healthy subjects, and were compared with those obtained by performing anorectal manometry in long-standing T1D individuals (T1D+ESRD) using a custom-designed, open-tip, 14-Fr diameter, PVC probe with seven lumens 15 and a 4-cm latex balloon tied at the end of the probe (Bioengineering Laboratories Plc., Milan, Italy) (Carrington et al., 2014; Remes-Troche et al., 2010). The sphincter length was measured after a 10-minute run-in period, anal pressure was recorded for 15 minutes in resting conditions. Subjects were then instructed to squeeze the anus as tightly as possible and for as long as possible-for at least 20 seconds. Inventors' study evaluated the following items: Resting Tone, Contraction Tone, Reflex Response, and Urgency Response.
Pathology, Immunohistochemistry and Electron MicroscopyColorectal endoscopy procedure was performed in healthy subjects, in long-standing T1D individuals (T1D+ESRD) at baseline and in SPK and K+T1D groups at 2, 4, and 8 years after transplantation using a Welch Allyn optic sigmoid scope. Intestinal mucosal samples were fixed in buffered formalin (formaldehyde 4% w/v and acetate buffer 0.05 M) and routinely processed in paraffin wax. 3 μm-thick sections of each enrolled case were stained with Hematoxylin & Eosin (H&E) for morphological evaluations. For immunohistochemistry, 3 μm-thick sections were mounted on poly-L-lysine coated slides, deparaffinized and hydrated through graded alcohols to water. After antigen retrieval, performed by dipping sections in 0.01 M citrate buffer, pH 6 for 10 minutes in a microwave oven at 650W as well as endogenous peroxidase activity inhibition, performed by dipping sections in 3% hydrogen peroxide for 10 minutes, incubation with primary antibodies was performed at 4° C. for 18-20 hours, followed by the avidin-biotin complex procedure (Hsu et al., 1981). Immunoreactions were developed usmg 0.03% 3,3′ diaminobenzidine tetrahydrochloride, and then sections were counterstained with Harris' hematoxylin. The following antibodies were used: Ki67 (monoclonal, clone MIB M1B1, 1:100 dilution, Dako, Carpinteria, Calif., USA), aldehyde dehydrogenase (monoclonal, clone 44/ALDH, 1:1000 dilution, Transduction Laboratories, Franklin Lakes, N.J., USA), EphB2 (monoclonal, clone 48CT12.6.4, 1:200 dilution, Lifespan Biosciences, Seattle, Wash., USA), LGR5 (monoclonal, clone 2A2, 1:100 dilution, Origene Technologies, Rockville, Md., USA), hTERT (monoclonal, clone Y182, 1:500 dilution, Millipore, Billerica, Mass., USA), glicentin (polyclonal, 1:1250 dilution, Milab, Malmo, Sweden), pancreatic polypeptide (polyclonal, 1:500 dilution, Peninsula, Belmont, Calif., USA), PYY (polyclonal, 1:1000 dilution, Biogenesis, Bournemouth, UK), serotonin (monoclonal, clone YC5, 1:50 dilution, Biogenesis), somatostatin (polyclonal, 1:550 dilution, Dako), IGF-I (polyclonal, 1:500, Abcam) and IGF-IR (polyclonal, 1:100, Cell Signaling Technologies), (Fiorina et al., 2003). For ultrastructural studies, samples were fixed for 2 hours at 4° C. in a mixture of 2% paraformaldehyde and 2% glutaraldehyde in 0.05 M cacodylate buffer, pH 7.3. They were post-fixed in 1% osmium 15 tetroxide for 1 hour at room temperature, then dehydrated and embedded in Epon-Araldite. Ultrathin sections were cut with a diamond knife and mounted on 200-mesh nickel grids, previously coated with a Formvar film. Ultrathin sections were stained with aqueous uranyl acetate and Reynold's lead citrate solutions and subsequently examined with a Philips Morgagni 268D electron microscope. Cases were grouped according to the number of neuroendocrine vesicles (n>3 and n<3) for statistical analysis. For crypt isolation, tissue was collected in a sample containing a mixture of antibiotics and processed as described in the next paragraph. The immunostaining intensity for EphB2 was graded as 1 (negative EphB2 gradient to few cells positive per crypt per field) to 5 (strong EphB2 gradient in all longitudinal crypts). An anti-IGFBP3 primary antibody (polyclonal, 1:50 dilution, Sigma Aldrich) was immunohistochemically tested in liver biopsies 25 from patients with type 1 diabetes. Liver biopsies without pathological findings were used as controls. All of these tissue samples came from the files stored at the Unit of Pathology of the Department of Biomedical, Biotechnological, and Translational Sciences, University of Parma, Parma, Italy. The immunostaining intensity was graded as 1 (mild), 2 (moderate), and 3 (strong), while its diffusion as 1 (focal), 2 (zonal), and 3 (diffuse).
ImmunoflurescenceImmunofluorescence samples obtained from liver biopsies were observed using a confocal system (LSM 510 Meta scan head integrated with the Axiovert 200 M inverted microscope; Carl Zeiss, Jean, Germany) with 63× oil objective. Images were acquired in multitrack mode, using consecutive and independent optical pathways. The following primary antibodies were used: rabbit IGFBP3 (1:10, Sigma) mouse Hep Par-1 (1:20, monoclonal, Dako), mouse CD163 (1:10, cloneMRQ26, CellMarque).
Mini-guts co-cultured with/without IGFBP3, with/without long-standing T1D serum+high glucose (35 mM Glucose) and those obtained from crypts of T1D+ESRD individuals, were stained with Vimentin, Citocheratin 20, Aldheide Dehydrogenase and Synaoptifisin for immunofluorescence analysis to assess expression of cell lineages markers (
Paraffin sections of human colon mucosa were de-paraffinized and re-hydrated according to standard procedures. After treatment of sections using 0.2M HCl for 15 minutes at room temperature, sections were washed 3 times in PBS and incubated for 15 min at 37° C. in proteinase K (30 μg/ml in PBS). 0.2% glycine in PBS was added for 1 minute in order to neutralize Proteinase K activity, and samples were washed twice in PBS. After post-fixation in 4% PFA for 10 min at room temperature and 3 washes in PBS, histone acetylation was achieved by incubating samples two times for 5 min in an aqueous solution containing 1.5% triethanolamine, 0.15% HCl, and 0.6% acetic anhydride. Samples were then washed and pre-hybridized for 1 hour at 68° C. in hybridization solution (50% formamide, 5×SSC, pH4.5, 2% Blocking Reagent (Roche), 0.05% CHAPS (Sigma), 5 mM EDTA, 50 μg/ml Heparin (Sigma) and 50 μg/ml yeast RNA. For TMEM219, the digoxigenin-labelled probe was diluted 750 ng/ml in hybridization solution and incubated for 24 hrs at 65° C. Post-hybridization washes were performed 3×20 min in 50% Formamide/2×SSC at 65° C. Sections were rinsed in TBS-T buffer (0.1M TrisHC1 pH7.5, 0.15M NaCl, 0.1% Tween20) and blocked for 30 min at room temperature in Blocking Solution (0.5% Blocking Reagent, 10% sheep serum in TBS-T). Sheep anti-DIG antibody (Fab fragment, Roche) was diluted 1/2000 in Blocking Solution and incubated overnight at 4° C. After this, samples were washed in TBS-T and then in NTM buffer (0.1M Tris pH9.5, 0.1M NaCl, 0.05M MgCl2) and developed in NBT/BCIP solution (Roche) for 24 hrs.
CoSC Characterization Crypt PurificationMuscle layer and sub-mucosa were carefully removed from human fresh rectal biopsy specimens, and mucosa was incubated with a mixture of antibiotics (Normocin, [Invivogen, San Diego, Calif. 92121, USA], Gentamycin [Invitrogen, Carlsbad, Calif., USA] and Fungizone [Invitrogen]) for 15 minutes at room temperature (RT). Next, tissue was cut into small pieces and incubated with 10 mM Dithiotreitol (DTT) (Sigma, St. Louis, Mo. 63103, USA) in PBS 2-3 times for 5 minutes at RT. Samples were then transferred to 8 mM EDTA in PBS and slowly rotated for 60-75 minutes at 4° C. Supernatant was replaced by fresh PBS, and vigorous shaking of the sample yielded supernatants enriched in colonic crypts. Fetal bovine serum (FBS, Sigma) was added to a final concentration of 5%, and fractions were centrifuged at 40×g for 2 minutes in order to remove single cells. This washing procedure was repeated 3 times with Advanced DMEM/F12 (ADF, Gibco) medium supplemented with 2 mM GlutaMax (Invitrogen), 10 mM HEPES (Sigma), and 5% FBS (Sigma).
200-300 isolated human colonic crypt units were mixed with 50 μl matrigel and plated on pre-warmed 24-well culture dishes as already described. After solidification (15-20 minutes at 37° C.), crypts were overlaid with 600 μl complete crypt culture medium [Wnt3a-conditioned medium and Advanced DMEM/F12 (Life Technologies, Grand Island, N.Y.) 50:50, supplemented with Glutamax, 10 mM HEPES, N-2 [lx], B-27 without retinoic acid [lx], 10 mM Nicotinamide, 1 mM N-Acetyl-L-cysteine, 50 ng/ml human EGF (Life Technologies, Grand Island, N.Y.), 1 μg/ml RSPO1 (Sino Biological, Beijing, China), 100 ng/ml human Noggin (Peprotech, Rocky Hill, N.J., USA), 1 μg/ml Gastrin (Sigma-Aldrich, St. Louis, Mo.), 500 nM LY2157299 (Axon MedChem, Groningen, The Netherlands), 10 μM SB202190 (Sigma) and 0.01 μM PGE2 (Sigma)]. Medium was replaced every other day. Rock inhibitor Y-27632 (10 μM, Sigma) was added to the cultures for the first 2-3 days. Purified crypts were directly cultured for 8 days. Cell Lineages markers for enterocytes and enteroendocrine cells were assessed in the mini-guts and in the EphB2+ and EphB2− sorted single cells with RT-PCR by testing: CHGA, KRT20 and EPCAM (Life Technologies, Grand Island, N.Y.). Colony forming efficiency (%) was evaluated on freshly isolated crypts in order to exclude that the bioptic procedure and the isolation processing could have compromised their efficiency in forming mini-guts in in vitro culture. DAPI staining was performed to confirm number of nuclei in freshly isolated crypts from CTRL and T1D+ESRD subjects. Developed mini-guts with at least 1 crypt domain were also counted and percentage was calculated in order to add a more quantitative criteria to measure developed mini-guts (
Glucose levels (T1D+ESRD vs. CTRL, 178±47.5 vs 90±5.5 mg/dl, p0.0001);
Insulin levels (T1D+ESRD vs. CTRL, 12.9±4.6 vs 5.8±1.6 μIU/ml, p=0.009).
The expression of the CoSC markers EphB2 (APC anti-human EphB2 antibody, R&D, Minneapolis, Minn.) and LGR5 (PE anti-human LGR5, Origene, Rockville, Md.) was determined by flow cytometry by excluding CD45- and -positive cells (V450 anti-human CD45 and CD11b, BD Biosciences, San Jose, Calif.). Propidium iodide (PI) was added (10 μg/ml) to exclude dead cells. EphB2+ cells were also sorted by flow cytometry to obtain a single cell suspension for culturing purposes. Intracellular detection of human-tert (hTERT) was performed by permeabilizing cells and staining with primary anti-human hTERT antibody (GeneTex, Irvine, Calif.) followed by DAPI anti-goat secondary antibody (Life Technologies). With regard to the analysis, cells were all first gated as PI− before the assessment of other surface or intracellular markers. Samples were run on a BD LSR-Fortessa and analyzed by FSC Express 3.0 (DeNovo Software, Los Angeles, Calif., USA).
In Vitro Mini-Gut Generation StudyCrypts were isolated from healthy subject rectal biopsy samples and cultured as previously described to generate mini-guts. To create hyperglycemic conditions, the culturing medium was modified by adding glucose at different concentrations (35 mM: high glucose; 5 mM: normal glucose). To mimic uremic conditions, human uremic serum obtained from long-standing T1D individuals with ESRD was added to crypts, which were cultured as reported in the crypt culturing methods section. After 8 days, crypts were collected, and the morphology, mini-gut growth, expression of intestinal signature markers (EphB2, LGR5, h-TERT), IGF-IR and TMEM219 (Life Technologies), and Caspase 9 (Life Technologies) were examined using RT-PCR. A pan-caspase inhibitor (caspase inhibitor Z-VAD-FMK, 20 mM, Promega, Madison, Wis.), a Caspase 8 selective inhibitor (Z-IETD-FMK, BD Pharmingen), a Caspase 9 selective inhibitor (Z-LEHD-FMK, BD Pharmingen), a caspase3 inhibitor Z-DEVD-FMK (BD Pharmingen) were used in vitro in mini-guts to confirm the antiapoptotic effect of IGFBP3.
To culture isolated crypts with crypts culturing medium containing healthy subjects human serum, namely CTRL serum, in place of regular FBS, L-Wnt3 cells were grown in 10% CTRL serum to generate conditioned medium that was further added 50:50 to Advanced DMEM/F 12 medium in order to obtain the crypts culture medium as previously described (see Crypt purification).
To assess the properties of sorted EphB2+ cells in generating mini-guts, 2000 sorted cells were mixed with 50 μl matrigel and plated on pre-warmed 24-well culture dishes. After solidification of the matrigel (10-15 min at 37° C.), cells were overlaid with “single cell growth medium” (=complete crypt culture medium+10 M Rock inhibitor Y-27623). Medium was replaced with fresh single cell growth medium every other day. Rock inhibitor was included in the culture medium for seven to nine days.
ImmunoblottingTotal proteins of intestinal bioptic samples were extracted in Laemmli buffer (Tris-HCl 62.5 mmol/1, pH 6.8, 20% glycerol, 2% SDS, 5% β-mercaptoethanol) and their concentration was measured (Lowry et al., 1951). 35 μg of total protein was electrophoresed on 7% SDS-PAGE gels and blotted onto nitrocellulose (Schleicher & Schuell, Dassel, Germany). Blots were then stained with Ponceau S. Membranes were blocked for 1 h in TBS (Tris [10 mmol/1], NaCl [150 mmol/1]), 0.1% Tween-20, 5% non-fat dry milk, pH 7.4 at 25° C., incubated for 12 h with 200 mg/ml of a polyclonal anti-goat EphB2 antibody or polyclonal anti-goat LGR5 antibody (Santa Cruz Biotechnology, Santa Cruz, Calif., USA) or monoclonal IGF-IR (Santa Cruz Biotechnology) and polyclonal TMEM219 (R&D, Minneapolis, Minn.) diluted 1:200 or with a monoclonal mouse anti-(3-actin antibody (Santa Cruz Biotechnology) diluted 1:1000 in TB S-5% milk at 4° C., washed four times with TBS-0.1% Tween-20, then incubated with a peroxidase-labeled rabbit anti-goat IgG secondary antibody (or rabbit anti mouse for (3-actin) diluted 1:1000 (Santa Cruz Biotechnology) in TBS-5% milk, and finally washed with TBS-0.1% Tween-20. The resulting bands were visualized using enhanced chemiluminescence (SuperSignal; Pierce, Rockford, Ill., USA).
Live Imaging of Intestinal Crypt GrowthLive imaging of mini-guts, obtained by purification and culture of intestinal crypts of CTRL, T1D+ESRD and SPK individuals, was performed on a Zeiss Axiovert S 100 equipped with environmental control (from Oko-Lab, Italy) with a chamber in which a humidified premixed gas consisting of 5% CO2 and 95% air was infused, and the whole setup was set at 37° C. Images were acquired at 20-minute intervals for 72 hours. Images were acquired and processed using Time Lapse (Oko-Lab, Italy) and, if necessary, image editing was performed using Adobe Photoshop Elements 7.0.
Morphology Imaging AnalysisThe images of mini-guts were taken at day 0, 5 and 8 days by inverted microscopy Leica DH/RB and acquired with Axio Vision AC Release 4.3. Pictures reported in figures represent mini-guts at day 5, 10× magnification.
Transcriptome ProfilingTotal RNA was isolated from purified intestinal crypt suspension using the RNeasy Mini Kit (Qiagen, Valencia, Calif.) with on-column DNase I digestion. Next, 3 μg total RNA from each sample was reverse-transcribed using the RT2 First Strand kit (C-03; SABiosciences, Frederick, Md.). The inventors used the Human Stem Cell RT2 Profiler PCR Arrays (PAHS-405Z), the human Stem Cell Signaling PCR Array (PAHS-047Z) and a custom array with the following genes: AXIN2, OLFM4, BMI1, RNF43, CDCA7, SLC12A2, CDK6, SOX9, DKC1, ZNRF3, ETS2, EPHB2, FAM84A, LGR5, GPX2, ACTB (SABiosciences). The Profiler PCR Arrays measure quantitatively the expression of a panel of genes using SYBR Green-based real-time PCR (Kosinski et al., 2007). To assess the transcriptome profiling of apoptotic markers and oxidative stress markers the Human Apoptosis PCR Arrays (PAHS-012Z, SABiosciences) and the Human Oxidative Stress PCR Arrays (PAHS-065Z, SABiosciences) were used.
qRT-PCR Analysis
RNA from purified intestinal crypts was extracted using Trizol Reagent (Invitrogen), and qRT-PCR analysis was performed using TaqMan assays (Life Technologies, Grand Island, N.Y.) according to the manufacturer's instructions. The normalized expression values were determined using the AACt method. Quantitative reverse transcriptase polymerase chain reaction (qRT-PCR) data were normalized for the expression of ACTB, and AACt values were calculated. Statistical analysis compared gene expression across all cell populations for each patient via one-way ANOVA followed by Bonferroni post-test for multiple comparisons between the population of interest and all other populations. Statistical analysis was performed also by using the software available RT2 profiler PCR Array Data Analysis (Qiagen). For two groups comparison Student t test was employed. Analysis was performed in triplicates after isolation of fresh crypts and/or after 8 days of culture of miniguts. Table I-B reports the main characteristics of primers used.
IGF-I and IGFBP3 levels in the pooled sera/plasma of all groups of subjects and in all groups of treated and untreated mice was assessed using commercially available ELISA kits, according to the manufacturer's instructions (R&D and Sigma).
Human immortalized hepatoma cell line HuH-7 was cultured for 5 days in DMEM 10% FBS at different glucose concentrations: 5.5 mM, 20 mM and 35.5 mM. Culturing supernatant was collected, and IGFBP3 was assessed using an IGFBP3 ELISA kit (Sigma) according to the manufacturer's instructions. Collected cells were separated by trypsin and counted with a hemacytometer.
Insulin levels were assayed with a microparticle enzyme immunoassay (Mercodia Iso-Insulin ELISA) with intra- and inter-assay coefficients of variation (CVs) of 3.0% and 5.0%.
Recombinant Proteins and Interventional StudiesRecombinant human IGF-I (Sigma, 13769), (IGF-I), recombinant human IGFBP3 (Life Technologies, 10430H07H5), (IGFBP3), and anti-IGF-IR (Selleckchem, Boston, OSI-906) were added to crypt cultures at day+2 from isolation. IGFBP3 (Reprokine, Valley Cottage, NY) was administered to naïve and to STZ-treated B6 mice at 0.3 mg/mouse/day for 15 days; IGF-I (Reprokine) and ecto TMEM219 were administered in vivo to STZ-treated B6 mice after 2 weeks of diabetes at a dose of 5 μg/mouse/day for 20 days and 100 μg/mouse/day for 15 days respectively. Other molecules tested in in vitro mini-guts assay and added to crypt cultures at day+2 from isolation: Adiponectin (R&D), Thymosin (34 (Abcam), C-reactive protein (Merck Millipore), Cystatin C (Cell Signaling Technologies), Chromogranin A (Life Technologies), Fructosebisphosphate aldolase (Novoprotein), Osteopontin (R&D), Ribonuclease pancreatic (RNASE, Novoprotein), Serum amyloid A protein (Abcam), Mannan-binding lectin serine protease 1 (MASP1, Novoprotein), Tumor necrosis factor-alpha (TNF-alpha, R&D), FaS Ligand (FasL, R&D). Hydrogen peroxide (H2O2, 50 μM) was also tested in the mini-guts assay.
Generation of Recombinant Human Ecto TMEM219Recombinant human ecto-TMEM219 was generated using E. Coli as expression host for synthesis.
Briefly, gene sequence of extracellular TMEM219 was obtained:
The DNA sequence of extracellular TMEM219 was cloned into a high copy-number plasmid containing the lac promoter, which is then transformed into the bacterium E. coli. Addition of IPTG (a lactose analog) activated the lac promoter and caused the bacteria to express extracellular TMEM219 (ecto TMEM219). SDS-P AGE and Western Blot were used to confirm purity higher than 90%. The molecular weight of the new generated protein recombinant human ecto TMEM219 was 80 kda.
Crypts from healthy subjects were isolated and cultured as previously described and ecto TMEM219 was added to the culture at three concentrations (260 ng/ml, 130 ng/ml and 75 ng/ml) as compared to IGFBP3 concentration used (2:1, 1:1 and 1:2) and appropriate controls were set up for each concentration. After 8 days of culture, caspase 8 and 9 expression, CoSCSC signature markers (EphB2 and LGR5) expression, number of developed mini-guts, were further assessed.
Small RNA InterferenceIsolated crypts obtained from healthy subjects were grown to generate in vitro mini-guts in complete medium and in culturing medium modified by adding high glucose and long-standing T1D serum as previously described (see in vitro mini gut generation study in online methods). After 72h of culture, which allowed the crypts to recover, 750 ng of small interfering RNA (siRNA; Flexitube siRNA SI04381013, Qiagen, Valencia, Calif.) in 100 μl culture medium without serum and with 6 μl HiPerFect Transfection Reagent (Qiagen) were incubated at room temperature to allow for the formation of transfection complexes. Crypts were incubated with these transfection complexes under their normal growth conditions for 6h. Analysis of gene silencing was performed at 24, 48 and 72h by evaluating the percentage of normal mini-gut development. Control siRNA was used as a negative control to confirm the effect of gene silencing.
Proteomic Analysis8 μl of pooled serum from 10 patients per group were depleted using a ProteoPrep 20 spin column (Sigma), thus allowing for the removal of the 20 highly abundant proteins. The procedure was twice repeated in order to obtain ˜99% depletion, according to the manufacturer's instructions. The recovered supernatant was analyzed to determine total protein concentration using the Direct Detect IR spectrophotometer and BSA as a standard. In order to obtain enough protein for proteomic analysis, 32 μl from each pool were processed as above described. 40 μg of total protein from each sample was in-solution digested using the Filter Aided Sample Preparation (FASP) protocol as reported in the literature (Wisniewski et al., 2009). Samples were desalted using C18 homemade tip columns (C18 Empore membrane, 3M) and injected into a capillary chromatographic system (EasyLC, Proxeon Biosystems, Thermo Scientific). Peptide separations were performed on a homemade 25 cm reverse phase spraying fused silica capillary column, packed with 3 μm ReproSil Pur 120 C18-AQ. A gradient of eluents A (pure water with 2% v/v ACN, 0.5% v/v acetic acid) and B (ACN with 20% v/v pure water with 0.5% v/v acetic acid) was used to achieve separation (0.15 μL/minute flow rate) (from 10 to 35% B in 230 minutes, from 35 to 50% B in 5 minutes and from 50 to 70% B in 30 minutes). Mass spectrometry analysis was performed using an LTQ-Orbitrap mass spectrometer (Thermo Scientific, Waltham, Mass.) equipped with a nanoelectrospray ion source (Proxeon Biosystems). Full scan mass spectra were acquired with the lock-mass option and resolution set to 60,000. The acquisition mass range for each sample was from m/z 300 to 1750 Da. The ten most intense doubly and triply charged ions were selected and fragmented in the ion trap using a normalized collision energy 37%. Target ions already selected for the MS/MS were dynamically excluded for 120 seconds. All MS/MS samples were analyzed using Mascot (v. 2.2.07, Matrix Science, London, UK) search engine to search the UniProt_Human Complete Proteome_cp _hum_2013_12. Searches were performed with trypsin specificity, two missed cleavages allowed, cysteine carbamidomethylation as fixed modification, acetylation at protein N-terminus, and oxidation of methionine as variable modification. Mass tolerance was set to 5 ppm and 0.6 Da for precursor and fragment ions, respectively. To quantify proteins, the raw data were loaded into the MaxQuant software version 1.3.0.5 (Cox et al., 2011). Label-free protein quantification was based on the intensities of precursors. Peptides and proteins were accepted with an FDR less than 1%, two minimum peptides per protein. The experiments were performed in technical triplicates. The complete dataset of proteins, obtained by proteomic analysis (Table I-C), was analyzed by Student's t-test using MeV software v. 4_8_1. 47 proteins, which were significantly different (p-value<0.01) in control pool versus T1D-ESDR pool, were further submitted to hierarchical clustering analysis.
Among the 46 factors that segregated separately in long-standing T1D subjects and healthy controls, the inventors first selected those with a more significant difference in LFQ intensity in comparing the two groups (p>0.005), leading to the exclusion of 12 factors (
C57BL/6 (B6) mice were obtained from the Jackson Laboratory, Bar Harbor, Me. All mice were cared for and used in accordance with institutional guidelines approved by the Harvard Medical School Institutional Animal Care and Use Committee. Mice were rendered diabetic with streptozotocin injection (225 mg/kg, administered i.p.; Sigma). Diabetes was defined as blood glucose levels >250 mg/dL for 3 consecutive measures. Diabetic enteropathy was assessed as follows: briefly, the entire intestine was extracted from sacrificed mice and flushed with PBS. The extreme part of the colon was then cut and divided in two pieces. One piece of colon tissue was directly submerged in formalin while the other was cut longitudinally to expose the lumen and the internal mucosa and then submerged in formalin. Tissue was then paraffin embedded and processed for H&E and immunostaining. In addition, colonic tissue was also cut and isolation of colonic stem cells was performed as previously described (Merlos-Suarez et al., 2011). Briefly, colon was cut into 2-4 mm pieces and the fragments were washed in 30 mL ice-cold PBS. Fragments were the transferred in 50 ml tubes containing pre-warmed 20 mM EDTA-PBS and incubated at 37° C. for 30 min. After incubation the suspended tissue was transferred into tube containing 30 ml cold PBS and centrifuged. Crypts were resuspended in 13 ml cold DMEMF12, washed with PBS and digested in 5-10 ml of trypsin/DNAse solution at 37° C. for 30 min. Crypts were then resuspended in DMEMF12/EDTA, filtered in 40 micron strainer twice and washed.
Finally, crypts were then resuspended in flow medium (DMEM+FBS+EDTA) and stained for anti EphB2-APC (R&D), mouse anti-CD45-PeRCP and mouse anti-CD1 lb-PE (BD Pharmingen). Samples were run using a FACSCalibur Analyzer and data analyzed with FlowJo.
Part of the tissue was also snap frozen and stored in Tryzol to perform RT-PCR studies for the following markers:
Finally, plasma and serum were collected to perform analysis of IGF-I (IGF-I ELISA kit, R&D), IGFBP3 (IGFBP3 ELISA kit, R&D) and insulin levels (Mercodia Mouse Insulin ELISA kit). Blood glucose was monitored twice a week for the 8 weeks in order to confirm diabetes onset and permanence.
Statistical AnalysisData are presented as mean and standard error of the mean (SEM) and were tested for normal distribution with the Kolmogorov-Smirnov test and for homogeneity of variances with Levene's test. The statistical significance of differences was tested with two-tailed t-test and the chi-square (x2) tests. Significance between the two groups was determined by two-tailed unpaired Student's t test. For multiple comparisons, the ANOVA test with Bonferroni correction was employed. All data were entered into Statistical Package for the Social Science (SPSS®, IBM®, SPSS Inc., Chicago, Ill.) and analyzed. Graphs were generated using GraphPad Prism version 5.0 (GraphPad Software, La Jolla, Calif.). All statistical tests were performed at the 5% significance level.
Results Intestinal Dysfunction and Clinical Symptoms are Present in Long-Standing TJDThe inventors first characterized intestinal morphology and function in a population of individuals with long-standing T1D and end stage renal disease (T1D+ESRD) and in healthy subjects (CTRL). Severe intestinal symptoms, such as diarrhea, abdominal pain and constipation, were evident in T1D+ESRD individuals as assessed using the Gastrointestinal Symptom Rating Scale (GSRS) questionnaire (
The characterization of colonic crypts, revealed a significant reduction in EphB2+ expression and in the number of aldehyde dehydrogenase (Aldh)+ immunoreactive cells, both markers of local stem cells (Carpentino et al., 2009; Jung et al., 2011), in T1D+ESRD individuals as compared to healthy subjects (
Analysis of —CoSC signature genes revealed that LGR5, EphB2 (Gracz et al., 2013; Merlos-Suarez et al., 2011), h-TERT (Breault et al., 2008) and other intestinal stem cell marker genes (Hughes et al., 2011; Munoz et al., 2012; Ziskin et al., 2013) were significantly underexpressed in T1D+ESRD as compared to healthy subjects as well (
In order to evaluate CoSC self-renewal properties, the inventors used the in vitro mini-gut assay. Indeed, crypts isolated from T1D+ESRD individuals and cultured in vitro for 8 days formed small spheroid mini-guts that failed to grow as compared to healthy subjects (
In order to identify potential circulating factors that may serve as enterotrophic hormones and may have a role in regulating the CoSCs, the inventors compared the serum proteome of healthy subjects with T1D+ESRD individuals using an unbiased proteomic array. A clear proteomic profile was evident in T1D+ESRD individuals as compared to healthy subjects, with more than 50% of the detected proteins segregating in either one group or the other (
To further elucidate the role of circulating IGF-I and IGFBP3 in the regulation of the CoSCs and of intestinal epithelial proliferation, the inventors demonstrated the expression of IGF-IR and of IGFBP3 receptor (TMEM219) on isolated crypts (
Other circulating proteins, which appeared altered in serum proteome of long-standing T1D individuals, were tested in the in vitro mini-gut assay and did not show any significant effect on mini-guts growth (
To further confirm that IGF-I/IGFBP3 dyad targets effectively CoSCs and not only crypts, the inventors tested its effect on single cell-derived mini-guts. The inventors flow sorted EphB2+ cells from isolated crypts and established that TMEM219 was highly expressed on their surface (
Moreover, expression of Caspase 8 and 9 was up regulated in IGFBP3-treated mini-guts and in those exposed to high glucose and long-standing T1D serum, while Ki67, marker of proliferation, was significantly under expressed (
Effect of the IGF-I/IGFBP3 Dyad on Previously Known Pathways that Control CoSCs
In order to clarify the effects of IGF-I/IGFBP3 dyad on pathways previously known to be involved in CoSC niche function (i.e. Wnt/Notch/BMP), the inventors obtained from their stem cell transcriptome profile the expression of niche specific gene transcripts. IGF-I restores significantly the expression of some factors associated with Wnt/Notch signaling pathways on mini-guts obtained from crypts of T1D+ESRD (
This confirms that IGF-I preserves the expression of some genes involved in Wnt/Notch/BMP signaling, but also that IGFBP3 acts independently on CoSCs, without major alterations in the expression of key-target genes of the other previously known pathways.
Effect of IGF/IGFBP3 Dyad on Apoptotic Patheways in CoSCsAn extensive transcriptome analysis performed to clarify the IGFBP3 caspase-mediated effect on mini-guts, (
Interestingly, anti-apoptotic genes (Bc12, Fas, No13) were significantly underexpressed in mini-guts grown from T1D+ESRD crypts as well, as compared to healthy subjects, while the majority of caspases related genes (Caspase 1, 5, 7, 8, 9, 14) were over expressed (
In order to further demonstrate the relevance of IGF-I/IGFBP3 circulating factors in vivo, the inventors tested the effects of IGF-I and IGFBP3 administration in a preclinical model of DE. After 8 weeks of chemically-induced diabetes (using streptozotocin [STZ]), C57BL/6 (B6) mice showed a reduced number of crypts in the colorectal tissue (
Treatment of Long-Standing T1D with Simultaneous Pancreas-Kidney Transplantation (SPK) Reverts Clinical and Morphological Features of DE
The gold standard treatment for long-standing T1D is SPK, which affords stable glycometabolic control, near-normalized risk factors and prolonged survival (Table VI) (Fiorina et al., 2004; Fiorina et al., 2005; Folli et al., 2010; Secchi et al., 1998; Smets et al., 1999).
However, individuals with T1D+ESRD are also treated with kidney transplantation alone but remain diabetic (K+T1D) (Fiorina et al., 2001). A significant improvement in gastrointestinal symptoms was evident over time after SPK in inventors' cohort of transplanted individuals, while the K+T1D group did not report any benefit (
Treatment of Long-Standing T1D with SPK Re-Establishes Intestinal Mucosa Morphology and Local Self-Renewal Properties
Analysis of intestinal mucosa samples showed a significant recovery in the structure of the epithelial compartment, with compensatory epithelial hyperplasia in the SPK group (
Treatment of long-standing TID with SPK is associated with an increase in Aldh+ cells (
It is concluded that treatment of long-standing T1D with SPK promotes restoration of CoSCs.
Treatment of Long-Standing T1D with SPK Restores Circulating IGF-I and IGFBP3
Broad proteomic analysis and targeted immunoassay, revealed a near-normalization of IGFBP3 and IGF-I serum levels after SPK (
In order to further demonstrate the IGFBP3-mediated detrimental effects on CoSCs, the inventors generated a recombinant protein based on the TMEM219 extracellular domain (ecto-TMEM219). Addition of ecto-TMEM219 (2:1 molar ratio with IGFBP3) to crypts obtained from CTRL and cultured with IGFBP3 abrogated the pro-apoptotic effect of IGFBP3 on mini-guts and preserved the regenerative properties of crypts to generate mini-guts (
Diabetic enteropathy represents a clinically relevant complication in individuals with T1D, as it is associated with lower quality of life, malnutrition and malabsorbtion (Bytzer et al., 2002; Faraj et al., 2007; Talley et al., 2001). Particularly, in individuals with long-standing T1D (T1D+ESRD), intestinal disorders occur with high frequency and severity (Cano et al., 2007; Wu et al., 2004), resulting in body mass loss and cachexia (Pupim et al., 2005), indicating that enteropathy is an important complication of long-standing T1D (Atkinson et al., 2013; Pambianco et al., 2006). Inventors' results demonstrate that individuals with long-standing T1D experienced severe intestinal disorders (Table VIII) and that these clinical conditions are associated with alterations of the intestinal mucosa, with reduced proliferation of intestinal epithelial cells and with signs of neural degeneration.
Similar features have also been reported in rodent models of T1D and DE (Domenech et al., 2011). Inventors' data, for the first time, link DE to a defect in CoSCs and implicate IGFBP3 as having an important role in the maintenance of intestinal epithelium homeostasis. While hyperglycemia is a prominent feature of T1D, inventors' in vitro studies suggest that this feature cannot fully explain DE and that circulating factors may play an important role. Proteomic analysis led to the identification of IGF-I as an enterotrophic factor involved in the homeostasis of CoSCs. The inventors then confirmed that IGF-I and IGFBP3 control CoSCs and that this axis is dysfunctional in long-standing T1D. Inventors' data indicate that IGF-I acts as a circulating enterotrophic factor that promotes crypt growth and controls CoSCs through IGF-IR, while IGFBP3 can block IGF-I signaling by binding circulating IGF-I and reducing its bioavailability. In addition, and most importantly, the inventors showed that IGFBP3 acts through a pro-apoptotic IGF-I-independent mechanism on CoSCs, which the inventors demonstrated express TMEM219 (the IGFBP3 receptor), thereby inducing the failure of mini-gut growth. This latter effect is Caspase 8 and 9-mediated and TMEM219-dependent; indeed, the absence of the IGFBP3 receptor (TMEM219) on CoSCs greatly diminished high glucose-associated CoSC injuries. T1D together with starvation and cachexia are characterized by low circulating IGF-I levels (Bondy et al., 1994; Giustina et al., 2014) due to reduced hepatic IGF-I release, which is controlled and stimulated by endogenous insulin (Le Roith, 1997; Sridhar and Goodwin, 2009). More importantly, hyperglycemia appeared to have a direct effect on hepatic synthesis and release of IGFBP3. IGFBP3 may thus act as a hepatic hormone that reduces intestinal absorptive capacity during hyperglycemia. Interestingly, SPK provided a proof of concept to the inventors' hypothesis and supported their findings regarding the existence of circulating factors that control CoSCs. The striking improvement of clinical and functional features of DE that the inventors observed in their study, associated with replenishment of the CoSCs and with restoration of the circulating IGF-I and IGFBP3, strengthens inventors' hypothesis. Finally, the newly generated ecto-TMEM219 recombinant protein improved DE in diabetic mice in vivo and restored the ability of mini-guts to grow normally in vitro, thus confirming the role of IGFBP3 in controlling CoSCs and paving the way for a novel potential therapeutic strategy. In summary, inventors' study shows that an IGFBP3-mediated disruption of CoSCs linked to hyperglycemia is evident in DE. The inventors suggest that circulating IGF-I/IGFBP3 represent a hormonal dyad that controls CoSCs and a novel therapeutic target for individuals with intestinal disorders, in particular caused by diabetes mellitus of long duration (Bondy et al., 1994; Bortvedt and Lund, 2012; Boucher et al., 2010).
Example 2 Materials and Methods Patients and Study Design60 individuals with T1D+ESRD registered on the waiting list for simultaneous pancreas-kidney transplantation (SPK) matched for (age 41 to 43 years old), gender, and duration of TID (29.4±1.8 years) were enrolled in the study. 20 subjects affected by type 1 diabetes (TID) from 10 to 20 years were enrolled as well. 20 healthy subjects matched for age and gender (CTRL), with normal renal function and normal glycometabolic parameters, were studied as well. TID+ESRD subjects were all on intensive insulin treatment at the time of enrollment in the study, while the CTRL group was not being administered any medication. All TID+ESRD subjects were on the same treatment as antiplatelet therapy (ASA) and anti-hypertension (angiotensin-converting-enzyme inhibitors), while 40 out of 60 received statins when enrolled in the study. Subjects with clear signs of inflammatory bowel diseases as well as celiac disease were not enrolled.
TID+ESRD individuals were followed up for 8 years (mean follow-up: 8.6±1.1 years) after receiving either SPK (n=30) or K+TID (n=30) transplantation according to the macroscopic surgical evaluation at the time of transplantation. Individuals taking an oral anticoagulant agent were not included. SPK individuals were all insulin-independent for the entire follow-up period, whereas K+TID individuals were on intensive subcutaneous insulin therapy. All subjects provided informed consent before study enrollment. Studies not included in the routine clinical follow-up were covered by an appropriate Institutional Review Board approval (Enteropatia-trapianto/01 Secchi/Fiorina).
IGFBP3 Assessment in Urine and SerumSerum was collected from 3 ml of fresh blood after centrifugation. Urine samples were collected fresh, centrifuged and stored at −80° C. IGFBP3 levels of all groups of subjects were assessed in frozen samples of serum and urine using commercially available ELISA kits, according to the manufacturer's instructions (R&D).
Statistical AnalysisCorrelation analysis and graphs were performed using Prism Graphpad software. Correlation analysis included assessment of IGFBP3 levels in serum vs. urine of individuals evaluated, IGFBP3 serum levels vs. estimated glomerular filtration rate (eGFR). Statistical significance was considered when p value was <0.05.
Measurement of Renal Function and Glycometabolic ParametersMDRD formula was used to assess estimated glomerular filtration rate (eGFR) in ml/min/m2. Blood tests included assessment of Creatinine, blood glucose, glycated hemoglobin in all subjects enrolled in the study focusing on comparing CTRL with T1D individuals and individuals with longstanding T1D (T1D+ESRD).
ResultsSerum IGFBP3 Levels Correlates with Urinary IGFBP3 Levels
Analysis of serum and urine levels of IGFBP3 in all subjects enrolled in the study documented a significant increase of both serum (
<350 pg/ml: normal levels (levels observed in healthy subjects)
350-500 pg/ml: altered levels (levels observed in T1D with a history of disease<5 years)
>500 pg/ml: indicative of enteropathy (levels observed in long-standing T1D, T1D subjects with other T1D complications, history of TID >5 years).
The inventors can also identify a normal range of urinary IGFBP3 levels (<350 pg/ml) by considering its correlation with serum IGFBP3 levels as represented in the gray area in
Five individuals with long-term (>5 years) inflammatory bowel disease (IBD) were enrolled and screened for peripheral levels of IGFBP3, IGF-I and the ratio of the IGFBP-3/IGF-I, according to the same method described above for the analysis of diabetic samples.
It was found that while IGFBP3 was slightly increased, the levels of IGFI were severely reduced with an overall alteration of IGFBP3/IGF1 ratio (
- The Diabetes Control and Complications Trial Res. Group (1993). N Engl J Med 329, 977-986.
- Atkinson, M. A. (2013). Type 1 diabetes. Lancet 383, 69-82.
- Barker, N. (2014). Nat Rev Mol Cell Biol 15, 19-33.
- Baxter, R. C. (2013). J Cell Commun Signal 7, 179-189.
- Bondy, C. A., et al., (1994). Ann Intern Med 120, 593-601
- Bortvedt, S. F., and Lund, P. K. (2012). Curr Opin Gastroenterol 28, 89-98.
- Boucher, J., et al., (2010). Sci Signal 3, ra87.
- Breault, D. T., et al., (2008). Proc Natl Acad Sci USA 105, 10420-10425.
- Bytzer, P., et al., (2002). Am J Gastroenterol 97, 604-611.
- Camilleri, M. (2007). Diabetic gastroparesis. N Engl J Med 356, 820-829.
- Cano, A. E., et al., (2007). Am J Gastroenterol 102, 1990-1997.
- Carlone, D. L., and Breault, D. T. (2012). Cell Stem Cell 10, 2-4.
- Carpentino, J. E., et al., (2009). Cancer Res 69, 8208-8215.
- Domenech, A., et al., (2011). Int J Exp Pathol 92, 400-412.
- Faraj, J., et al., (2007). Diabet Med 24, 1235-1239.
- Feldman, M., and Schiller, L. R. (1983). Ann Intern Med 98, 378-384.
- Fiorina, P., et al. (2004). Diabetes 53, 2291-2300.
- Fiorina, P., et al. (2001). Diabetes 50, 496-501.
- Fiorina, P., et al. (2005). Diabetes Care 28, 1303-1310.
- Folli, F., et al. (2010). PLoS One 5, e9923.
- Giustina, A., et al., (2014). Acta Diabetol.
- Gracz, A. D., et al., (2013). Stem Cells 31, 2024-2030.
- Hughes, K. R., Sablitzky, F., and Mahida, Y. R. (2011). Inflamm Bowel Dis 17, 213-220.
- Jung, P., et al. (2011). Nat Med 17, 1225-1227.
- Le Roith, D. (1997). N Engl J Med 336, 633-640.
- Medema, J. P., and Vermeulen, L. (2011). Nature 474, 318-326.
- Merlos-Suarez, A., et al. (2011). Cell Stem Cell 8, 511-524.
- Munoz, J., et al. (2012). EMBO J 31, 3079-3091.
- Pambianco, G., et al., (2006). Diabetes 55, 1463-1469.
- Pupim, L. B., et al., (2005). Kidney Int 68, 2368-2374.
- Sato, T., and Clevers, H. (2013). Science 340, 1190-1194.
- Secchi, A., et al., (1998). Lancet 352, 65; author reply 66.
- Smets, Y. F., et al., (1999). Lancet 353, 1915-1919.
- Sridhar, S. S., and Goodwin, P. J. (2009). J Clin Oncol 27, 165-167.
- Stange, D. E., and Clevers, H. (2013). Stem Cells 31, 2287-2295.
- Talley, N.J., et al., (2001). Am J Gastroenterol 96, 71-76.
- van der Flier, L. G., and Clevers, H. (2009). Annual review of physiology 71, 241-260.
- Williams, A. C., et al., (2007). Cell Death Differ 14, 137-145.
- Wu, M. J., et al., (2004). Am J Kidney Dis 44, 322-327.
- Zeki, S. S., et al., (2011). Nature reviews. Gastroenterology & hepatology 8, 90-100.
- Zhao, J., Yang, J., and Gregersen, H. (2003). Diabetologia 46, 1688-1697.
- Ziskin, J. L., et al., (2013). Gut 62, 1012-1023.
- Levey, A. S., et al., (1999). Annals of internal medicine 130, 461-470.
- Svedlund, J., Sjodin, I., and Dotevall, G. (1988). Digestive diseases and sciences 33, 129-134.
- Canington, E. V., et al. (2014). Neurogastroenterology and motility: the official journal of the
- European Gastrointestinal Motility Society.
- Remes-Troche, J. M., et al., (2010). Diseases of the colon and rectum 53, 1047-1054.
- Hsu, S. M., Raine, L., andFanger, H. (1981). The j. of histochem. and cytochemistry: 29, 577-580.
- Fiorina, P., et al. (2003). Diabetes care 26, 1129-1136.
- Lowry, O. H., et al., (1951). The Journal of biological chemistry 193, 265-275.
- Kosinski, C., et al. (2007). PNAS 104, 15418-15423.
- Wisniewski, J. R., et al., (2009). Nature methods 6, 359-362.
- Cox, J., et al., (2011). Journal of proteome research 10, 1794-1805.
- Merlos-Suarez, A., et al. (2011) Cell Stem Cell 8, 511-524.
- Gersemann M, Stange E F, Wehkamp J. World journal of gastroenterology 2011; 17:3198-203.
- Schonhoff S E, Giel-Moloney M, Leiter A B. Endocrinology 2004; 145:2639-44.
- Jung P, Sato T, Merlos-Suarez A, et al. Nature medicine 2011; 17:1225-7.
- Merlos-Suarez A, Baniga F M, Jung P, et al. Cell stem cell 2011; 8:511-24.
- Piscaglia A C, Rutella S, Laterza L, et al. Journal of translational medicine 2015; 13:220.
- Senger S, Sapone A, Fiorentino M R, Mazzarella G, Lauwers G Y, Fasano A. PloS one 2015; 10:e0144634.
- Bartfeld S, Bayram T, van de Wetering M, et al. Gastroenterology 2015; 148:126-36 e6.
- Boman B M, Huang E. J. of din. oncol.: official j. of the American Society of Clin. Oncol 2008; 26:2828-3 8.
- D'Addio F, La Rosa S, Maestroni A, et al. Cell stem cell 2015; 17:486-98.
- D'Mello S, Trauernicht A, Ryan A, et al. Inflammatory bowel diseases 2012; 18:236-45.
- Kundu P, Genander M, Straat K, et al. Science translational medicine 2015; 7:281ra44.
Claims
1. An inhibitor of IGFBP3, wherein the inhibitor is an extracellular fragment of TMEM219, and wherein the inhibitor inhibits or blocks the interaction of IGFBP3 with its receptor TMEM219.
2.-4. (canceled)
5. The inhibitor of claim 1, wherein the fragment of TMEM219 is a fragment comprising an extracellular domain of TMEM219 capable of binding IGFBP3.
6. The inhibitor of claim 5, wherein the inhibitor is ecto-TMEM219 (SEQ ID NO: 3).
7.-9. (canceled)
10. A pharmaceutical composition comprising the inhibitor of claim 1 and pharmaceutically acceptable carriers.
11.-18. (canceled)
Type: Application
Filed: Apr 22, 2020
Publication Date: Oct 8, 2020
Inventors: Francesca D'Addio (Milan), Paolo Fiorina (Milan)
Application Number: 16/855,992
