METHODS FOR TREATING GI SYNDROME AND GRAFT VERSUS HOST DISEASE
It has been discovered that administering therapeutically effective amounts of an antibiotic that kills Gram-negative bacteria, together with an anti-ceramide antibody or anti-ceramide mimetic, treats and prevents an array of diseases mediated by cytolytic T lymphocyte (CTL)-induced killing and/or by damage to endothelial microvasculature, including Radiation GI syndrome, GvHD disease, inflammatory diseases and autoimmune diseases.
Latest Patents:
This application is a continuation of U.S. application Ser. No. 14/402,875, filed on Nov. 21, 2014, which is a National Stage of PCT Application No. PCT/US2013/042941, filed on May 28, 2013, which itself claims the benefit of and priority to U.S. Provisional Application Ser. No. 61/651,729, filed May 25, 2012, the entire contents of which are hereby incorporated by reference as if fully set forth herein, under 35 U.S.C. § 119(e).
STATEMENT OF GOVERNMENTAL INTERESTThis invention was made with government support under CA085704 awarded by the National Institutes of Health. The government has certain rights in the invention.
SEQUENCE LISTINGThe instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on May 25, 2017, is named 115872-1306 SL.txt and is 21,238 bytes in size.
BACKGROUNDRadiation remains one of the most effective treatments for a wide variety of malignant cells; however, healthy cells of the bone marrow, hair follicle, epidermis and gastrointestinal tract are extremely sensitive to radiation cell death, limiting the effective use of this therapy for the treatment of cancer. Radiation gastrointestinal (GI) syndrome is a typical consequence of radiation disease and it is a major lethal toxicity that may occur after a radiation/nuclear incident. The possibility of a radiologic disaster by way of nuclear detonation or accident has long existed, however the threat of attack with a radiation dispersal device has increased the urgency for safe and effective medical radiation countermeasures (MRCs). The Project BioShield Act and Department of Health and Human Services estimate that an effective MRC mitigator must be effective even when administered 24 h after a nuclear disaster, as this represents the minimum time necessary to mobilize treatment to a significant portion of an urban population. The Radiation Gastrointestinal (GI) Syndrome (RGS) is a major lethal toxicity that involves destruction of the intestinal stem cell compartment within crypt/villus units, resulting in mucosal denudation, loss of nutrient adsorption and susceptibility to infection by resident bacterial flora. Clinically, RGS presents with anorexia, vomiting, diarrhea, dehydration, systemic infection, and in extreme cases, septic shock and death. Despite extensive study of the effects of radiation on normal tissue, no effective prophylactic or therapeutic mitigator of the Radiation GI Syndrome are available for first responders, military personnel, or remediation workers entering a contaminated area.
Hematopoietic stem cell transplantation (including bone marrow transplants, peripheral blood stem cell donations, and stem cells from umbilical cord blood) is another way to treat advanced cancer; however, tissue transplants frequently evoke a variety of immune responses in the host, which results in rejection of the graft and graft versus host disease (“GvHD”). GvHD is a type of T-cell-mediated autoimmune disease. Hematopoietic stem cell transplants, especially bone marrow transplants are currently used to treat a number of malignant and non-malignant diseases including acute and chronic leukemias, myelomas, solid tumors (R. J. Jones, Curr Opin Oncol 3 (2), 234 (1991); G. L. Phillips, Prog Clin Biol Res 354B, 171 (1990)), aplastic anemias and severe immunodeficiencies (R. P. Gale, R. E. Champlin, S. A. Feig et al., Ann Intern Med 95 (4), 477 (1981); G. M. Silber, J. A. Winkelstein, R. C. Moen et al., Clin Immunol Immunopathol 44 (3), 317 (1987)). The conditioning regimen required prior to transplantation, designed to ablate or suppress the patient's immune system, renders the patient susceptible to neoplastic relapse or infection.
Recent use of unrelated and HLA non-identical donors has unfortunately increased the incidence of GvHD. While removal of T-cells from the donor marrow graft ameliorates GvHD, this strategy increases graft failure rates and markedly diminishes the therapeutically-beneficial graft-versus-tumor effect. As such, overall survival does not improve. Further, despite strong pre-clinical data, attempts to improve GvHD outcomes by diminishing inflammatory cytokine action by adding TNF antagonists to corticosteroids, the standard of care for acute GvHD, has provided limited therapeutic benefit.
Thus, there is an urgent need for alternative strategies to reduce the incidence and severity of radiation disease, GI syndrome, GvHD and other autoimmune diseases where GI damage leads to morbidity/mortality from sepsis in an animal as well as conditions characterized by high levels of endothelial apoptosis.
SUMMARY OF THE INVENTIONApplicants have determined that the prior techniques suffer from one or more deficiencies, including the scarcity of efficient means of preventing and treating diseases in animals such as GI syndrome, GvHD, radiation disease and certain autoimmune diseases associated with GI damage, as well as conditions characterized by high levels of endothelial apoptosis and diseases associated with the formation of ceramide-rich platforms (CRP) (hereinafter the “enumerated diseases”). Although most of the methods will be used to treat (including “mitigate”) an enumerated disease, if the treatment is administered early enough, for example before irradiation of the subject or before the subject receives a graft, then the corresponding disease (GI syndrome or GvHD, respectively), may be prevented.
In a first set of embodiments, methods are provided for preventing or treating an enumerated disease in an animal by administering a prophylactically or therapeutically effective amount of at least one antibiotic that targets Gram-negative bacteria together with an anti-ceramide antibody, or a biologically active fragment thereof. Antibiotics for use in the embodiments include broad spectrum antimicrobials that cover both Gram-positive and Gram-negative organisms, including quinolones (Baytril, ciprofloxacin), cephalosporins (cefepime, ceftazidine) or aminoglycosides (gentamicin, amikacin) together with a therapeutically effective amount of any anti-ceramide antibody. Anti-ceramide antibodies include but are not limited to a humanized anti-ceramide antibodies such as h2A2, or fully human anti-ceramide antibodies. Other antibodies that are useful in embodiments of the invention include anti-ceramide monoclonal (e.g., 1H4, 15D9, 5H9, and 2A2 and humanized versions thereof, and h2A2, and 2A2 IgM), polyclonal, or genetically-engineered antibodies, or a biologically active fragment or variant thereof. The monoclonal antibodies, in certain embodiments, can cross-react with ceramide. The mouse 2A2 antibody has been deposited with the ATCC. It has the Identification Reference by Depositor of Myeloma cell fused with spleen cells from Balb/c mouse: 2A2.1.1.1.1. and the ATCC®Patent Deposit Designation PTA-13418.
Prophylactically and therapeutically effective amounts of the anti-ceramide antibody are from about 0.1 mg/kg to about 100 mg/kg and from about 100 mg/kg to about 1000 mg/kg. Prophylactically and therapeutically effective amounts of the one or more antibiotics that are administered with the anti-ceramide antibody vary widely depending on the antibiotic, the formulation, the route of administration, etc. but can also range from about 0.1 mg/kg to about 100 mg/kg, about 100 mg/kg to about 1000 mg/kg. The antibiotic and the antibody can be administered simultaneously, for example in a single pharmaceutical formulation, or sequentially. “Therapeutic agents” herein refers to the anti-ceramide antibodies and mimotopes and the antibiotics targeting gram negative bacteria.
Quinolone antibiotics for use in various embodiments are selected from the group including Enrofloxacin (i.e., Baytril), Ciprofloxacin (i.e., Cipro and Proquin), Enoxacin (i.e., Penetrex), Gatifloxacin i.e., Gatiflo, Tequin and Zymar), Gemifloxacin (i.e., Factive), Levofloxacin (i.e., Levaquin), Lomefloxacin (i.e., Maxaquin), Moxifloxacin (i.e., Avelox), Norfloxacin (i.e., Noroxin), Ofloxacin (i.e., Floxin), Prulifloxacin, Sparfloxacin (i.e., Zagam), Trovafloxacin/Altrofloxacin (i.e., Trovan), Danofloxacin (i.e., A180), Difloxacin (i.e., Dicural), Marbofloxacin (i.e., Orbax), Orbifloxacin (i.e., Zeniquin), Naldixic acid (i.e., NegGram), Cinoxacin (i.e., Cinobac), Flumequine, Nalidixic acid, Oxolinic acid, Pipemidic acid, Piromidic acid, Rosoxacin, Fleroxacin, Pefloxacin, Rufloxacin, Balofloxacin, Grepafloxacin, Pazufloxacin, Temafloxacin, Tosufloxacin, Besifloxacin, Clinafloxacin, Garenoxacin, Sitafloxacin, Ibafloxacin, Pradofloxacin, and Sarafloxacin.
In addition to or instead of antibodies, mimotopes of one or more the ceramide epitopes or chemical compounds with essentially the same binding as mimotopes (i.e. derived from chemical backbone library screening) can be administered in therapeutically effective amounts.
To mitigate one or more of the enumerated diseases, the therapeutic agents are administered before symptoms of the disease are manifest (such as in the case of GvHD and certain defined autoimmune diseases), or after radiation exposure (as in the case of radiation disease or GI syndrome. In mitigating certain enumerated diseases, the therapeutic agents are administered before or after irradiation or before or after receipt of a graft, e.g., a hematopoietic stem cell transplant. Although most of the methods will be used to treat (including “mitigate”) an enumerated disease, if the treatment is administered early enough, for example before irradiation of the subject or before the subject receives a graft, then the corresponding disease (GI syndrome or GvHD, respectively), may be prevented.
In a second set of embodiments, a pharmaceutical composition is provided that is useful for preventing or treating one of the enumerated diseases in an animal, comprising prophylactically or therapeutically effective amounts of an anti-ceramide antibody such as h2A2, including a monoclonal antibody such as 1H4, 15D9, 5H9, and 2A2 and humanized versions thereof, and h2A2 and 2A2 IgM, a polyclonal, genetically-engineered or a fully human antibody, or a biologically active fragment or variant thereof or a statin, or imipramine, and one or more of the enumerated antibiotics described herein that treat or prevent gram negative bacterial infections, including broad-based antibiotics, in a pharmaceutically acceptable carrier.
Still other aspects, features, and advantages of the invention are readily apparent from the following detailed description, simply by illustrating a number of particular embodiments and implementations, including the best mode contemplated for carrying out the invention. The invention is also capable of other and different embodiments, and its several details can be modified in various obvious respects, all without departing from the spirit and scope of the invention. Accordingly, the drawings and description are to be regarded as illustrative in nature, and not as restrictive.
The present invention is illustrated by way of example, and not by way of limitation, in the figures of the accompanying drawings and in which like reference numerals refer to similar elements and in which:
It has now been discovered that administering an anti-ceramide antibody together with an antibiotic that targets Gram-negative bacteria results in unexpected synergy in preventing, mitigating and treating GvHD, radiation disease, GI syndrome, those autoimmune diseases where GI damage leads to morbidity/mortality from sepsis in an animal, and other diseases that are associated with CRP production (the “enumerated diseases”), including diseases mediated by cytolytic T lymphocyte (CTL)-induced killing and/or by damage to endothelial microvasculature. The antibody can be a monoclonal, polyclonal, genetically-engineered, humanized or a fully human antibody, or a biologically active fragment or variant thereof such as an Fv fragment or single domain antibodies. In addition to or instead of antibodies, mimotopes that bind to ceramide or chemical compounds with essentially the same binding as mimotopes can be administered in therapeutically effective amounts. Therefore certain embodiments are directed to methods of treating, mitigating or preventing an enumerated disease by administering therapeutic or prophylactic amounts of an anti-ceramide antibody, or biologically active fragment or variant thereof, or mimotope, together with prophylactically or therapeutically effective amounts of an antibiotic that targets Gram-negative bacteria. The useful antibiotics include broad spectrum antimicrobials that cover both Gram-positive and Gram-negative organisms, such as quinolones (Baytril, ciprofloxacin), cephalosporins (cefepime, ceftazidine) and aminoglycosides (gentamicin, amikacin). The antibody and antibiotic and mimotopes (herein “the therapeutic agents”) can be administered before or after irradiation or a tissue transplant, or upon diagnosis of GI syndrome, GvHD, an autoimmune disease involving damage to the gut or other disease associated with CRP formation. The therapeutic agents can be administered simultaneously, or at different times and via different routes.
Other embodiments are directed to pharmaceutical compositions that can be administered to prevent or treat an enumerated disease, comprising prophylactic or therapeutic amounts of an anti-ceramide antibody, or biologically active fragment or variant thereof, or ceramide-binding mimotopes together with an antibiotic that targets Gram-negative bacteria, including broad spectrum antibiotics.
In the following description, for the purposes of explanation, numerous specific details are set forth in order to provide a thorough understanding of the present invention. It will be apparent, however, to one skilled in the art that the present invention may be practiced without these specific details.
The invention is described with reference to specific embodiments. It will, however, be evident that various modifications and changes may be made thereto without departing from the broader spirit and scope of the invention. The specification and drawings are, accordingly, to be regarded in an illustrative rather than a restrictive sense. The invention is illustrated herein by the experiments described above and by the following examples, which should not be construed as limiting. The contents of all references, pending patent applications and published patents, cited throughout this application are hereby expressly incorporated by reference. Although specific terms are employed, they are used as in the art unless otherwise indicated.
The following terms as used herein have the corresponding meanings given here.
1. DEFINITIONSGenerally, nomenclatures used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, microbiology, genetics, protein, and nucleic acid, chemistry and hybridization described herein are those well-known and commonly used in the art. The methods and techniques of the present invention are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification unless otherwise indicated. See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, 2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989); Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates (1992, and Supplements to 2002); Harlow and Lan, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1990); Principles of Neural Science, 4th ed., Eric R. Kandel, James H. Schwart, Thomas M. Jessell editors. McGraw-Hill/Appleton & Lange: New York, N.Y. (2000). Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art.
“Antibiotics for use in the present invention” as used herein, mean any antibiotics that are effective against Gram-negative bacteria, including broad spectrum antimicrobials that cover both Gram-positive and Gram-negative organisms. These include quinolones (Baytril, ciprofloxacin), cephalosporins (cefepime, ceftazidine) or aminoglycosides (gentamicin, amikacin). In recent experiments, it was shown that Baytril improved survival from the GI syndrome, while sulfatrim (sulfonamide and trimethoprim) had no effect. This indicates that broad spectrum antimicrobials that cover Gram-negative organisms may be more effective than antibiotics that specifically target Gram-negative bacteria.
“Autoimmune diseases” that come within the scope of the enumerated diseases as used herein, mean, but are not limited to GvHD and those autoimmune diseases accompanied by GI damage
“Effective amount” as used herein, means an amount of a therapeutic agent, which produces a desired effect.
“Enumerated disease” as used herein, means any disease that can be treated (including mitigated) or prevented by administering treatment according to an embodiment of the invention. Enumerated diseases include Radiation disease, GvHD, GI syndrome and an autoimmune disease associated with GI damage, or diseases and conditions characterized by high levels of endothelial apoptosis including, rheumatoid arthritis and multiple sclerosis. Also included are diseases associated with CRP formation and diseases mediated by cytolytic T lymphocyte (CTL)-induced killing and/or by damage to endothelial microvasculature.
“Gastrointestinal (GI) syndrome” as used herein means the full syndrome will usually occur with a dose greater than approximately 10 Gy (1000 rads) although some symptoms may occur as low as 6 Gy or 600 rads.
“Mimotope” as used herein, means a macromolecule, often a peptide, which mimics the structure of an epitope. Because of this property it causes an antibody response similar to the one elicited by the epitope. An antibody for a given epitope antigen will recognize a mimotope which mimics that epitope. Mimotopes are commonly obtained from phage display libraries through biopanning. Mimotoptes are useful in initiating an immune response in the subject causing him/her to generate endogenous anti-ceramide antibodies that would treat the enumerated disease.
“Mitigating a disease” as used herein, means reducing or ameliorating a disease or symptom of a disease. For example, radiation disease can be mitigated by administering a therapeutic agent after exposure but prior to phenotypic expression of the disease (i.e. prior to the appearance of symptoms of the disease). Mitigation includes making the effects of disease less severe by avoiding, containing, reducing or removing it or a symptom of it. Mitigating an enumerated disease as described herein comes within the definition of “treating” an enumerated disease before symptoms occur. Amounts of therapeutic agents that mitigate a disease are herein referred to as “therapeutically effective amounts.”
“Prophylactically effective amount” as used herein, means an amount of a therapeutic agent, which, when administered to a subject, will have the intended prophylactic effect e.g., preventing or delaying the onset (or reoccurrence) of a disease or set of one or more symptoms, or reducing the likelihood of the onset (or reoccurrence) of the disease or set of symptoms. The full prophylactic effect does not necessarily occur by administration of one dose and may occur only after administration of a series of doses. Thus, a prophylactically effective amount may be administered in one or more administrations.
“Prophylactic, Mitigating and Therapeutic Agents” as used herein means any anti-ceramide antibody and also broad spectrum antimicrobials that cover Gram-negative organisms, such as quinolones (Baytril, ciprofloxacin), cephalosporins (cefepime, ceftazidine) or aminoglycosides (gentamicin, amikacin).
“Subject” as used herein, means an organism that is an object of a method or material, including mammals, e.g., humans, dogs, cows, horses, kangaroos, pigs, sheep, goats, cats, mice, rabbits, rats, and transgenic non-human animals. Synonyms used herein include “patient” and “animal.”
“Therapeutically effective amount” as used herein means an amount of a therapeutic agent that achieves an intended therapeutic effect in a subject, e.g., eliminating or reducing or mitigating the severity of a disease or set of one or more symptoms. The full therapeutic effect does not necessarily occur by administration of one dose and may occur only after administration of a series of doses. Thus, a therapeutically effective amount may be administered in one or more administrations.
“Treating” as used herein means taking steps to obtain beneficial or desired results, including clinical results, including mitigating, alleviating or ameliorating one or more symptoms of a disease; diminishing the extent of disease; delaying or slowing disease progression; ameliorating and palliating or stabilizing a metric (statistic) of disease. The effect may be prophylactic in terms of completely or partially preventing a conditions or disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a condition or disease and/or adverse effect attributable to the condition or disease. “Treatment” refers to the steps taken. It can include any treatment of a condition or disease in a mammal, particularly in a human, and includes: (a) preventing the condition or disease or symptom thereof from occurring in a subject which may be predisposed to the condition or disease but has not yet been diagnosed as having it; (b) inhibiting the condition or disease or symptom thereof, such as, arresting its development; and (c) relieving, alleviating or ameliorating the condition or disease or symptom thereof, such as, for example causing regression of the condition or disease or symptom thereof.
2. OVERVIEW Extracellular Cell Surface Ceramide is Required for Radiation ApoptosisIt has long been accepted that the clonogenic compartment of the gastrointestinal (GI) mucosa is the specific and direct target for radiation-induced GI damage. Characterized clinically by anorexia, vomiting, diarrhea, dehydration, systemic infection, and, in extreme cases, septic shock and death, the radiation gastrointestinal (GI) syndrome involves destruction of crypt/villus units, loss of mucosal integrity, and infection by resident enterobacterial flora (See Hendry, J. H., Potten C. S., Roberts N. P. The gastrointestinal syndrome and mucosal clonogenic cells: relationships between target cell sensitivities, LD50 and cell survival, and their modification by antibiotics. Radiat Res. 1983; 96 (1): 100-112; Hendry, J. H., Roberts S. A., Potten C. S. The clonogen content of murine intestinal crypts: dependence on radiation dose used in its determination. Radiat Res. 1992; 132 (1): 115-119; Potten C. S., A comprehensive study of the radiobiological response of the murine (BDF1) small intestine. Int. J. Radiat Biol. 1990; 58 (6): 925-973.)). While conventional radiobiology considers unrepaired or misrepaired DNA double strand breaks in stem cell clonogens (SCCs) as autonomous lesions leading to irreversible tissue injury, our recent studies have challenged this paradigm, presenting genetic evidence that acute endothelial damage also plays a major role in GI tract injury (Paris F., et al., Endothelial apoptosis as the primary lesion initiating intestinal radiation damage in mice. Science. 2001; 293 (5528): 293-297; Rotolo J. A., Kolesnick R., Fuks Z. Timing of lethality from gastrointestinal syndrome in mice revisited. Int J. Radiat Oncol Biol Phys. 2009; 73 (1): 6-8; Rotolo J. A., et al., Bax and Bak do not exhibit functional redundancy in mediating radiation-induced endothelial apoptosis in the intestinal mucosa. Int J. Radiat Oncol Biol Phys. 2008; 70 (3): 804-815). Within minutes of radiation exposure, endothelial acid sphingomyelinase (ASMase) is activated, catalyzing ceramide generation on the external plasma membrane of mouse and human endothelium to initiate apoptotic signaling (Stancevic B., Kolesnick R., Ceramide-rich platforms in transmembrane signaling. FEBS Lett. 2010; 584 (9): 1728-1740; Truman J. P., et al. Endothelial membrane remodeling is obligate for anti-angiogenic radio sensitization during tumor radiosurgery. PLoS One. 2010; 5 (9)). Endothelium displays 20-fold more ASMase than other mammalian cells, almost exclusively in a secretory form, which makes them particularly vulnerable to ceramide-induced apoptosis (Marathe S., et al. Human vascular endothelial cells are a rich and regulatable source of secretory sphingomyelinase. Implications for early atherogenesis and ceramide-mediated cell signaling. J. Biol. Chem. 1998; 273 (7): 4081-4088; Santana P., et al., Acid sphingomyelinase-deficient human lymphoblasts and mice are defective in radiation-induced apoptosis. Cell. 1996; 86 (2): 189-199.) Early evidence indicates that vascular compromise, consequent to endothelial cell apoptosis, impairs radiation-injured SCC DNA damage repair, resulting in SCC demise. In several mouse strains, endothelial apoptosis occurs between 8 and 15 Gy, which encompasses doses that cause both sublethal (≤14 Gy) and lethal (≥15 Gy) GI tract injury (5), beginning at 1 hour and peaking at 4 to 6 hours after irradiation (Maj J. G., Paris F., Haimovitz-Friedman A, Venkatraman E., Kolesnick R., Fuks, Z. Microvascular function regulates intestinal crypt response to radiation. Cancer Res. 2003; 63 (15): 4338-4341.) Attenuation of intestinal endothelial apoptosis by genetic inactivation of ASMase-mediated ceramide generation enhances SCC survival, facilitating repair of crypt damage and rescue of animals from GI lethality (Paris, F., et al. Endothelial apoptosis as the primary lesion initiating intestinal radiation damage in mice. Science. 2001; 293 (5528): 293-297); Rotolo, J. A., et al. Bax and Bak do not exhibit functional redundancy in mediating radiation-induced endothelial apoptosis in the intestinal mucosa. Int J Radiat Oncol Biol Phys. 2008; 70 (3): 804-815.) These observations provide the basis for developing a neutralizing anti-ceramide monoclonal antibody as a potential radiation countermeasure. Radiation targets both the gastrointestinal microvasculature and proliferating crypt stem cells. Apoptosis of the microvascular endothelium in the villus is an important lesion of the GI syndrome, occurring about 4 hours following radiation. Endothelial apoptosis converts lesions to the crypt clonogens from sublethal to lethal, resulting in loss of regenerative crypts and promoting GI toxicity. It has also been discovered that the endothelial injury couples to repair of DNA damage in the stem cell compartment making GI lethality a synthetic event resulting from direct damage to stem cell clonogens coupled to vascular dysfunction.
Pathophysiology of GI syndrome, also called Radiation Gastrointestinal (GI) Syndrome (RGS) requires depletion of stem cell clonogens (SCCs) within the Crypts of Lieberkühn, necessary for post-injury regeneration of gut epithelium. However, SCC reproductive death is not exclusively a result of DNA damage, but is critically coupled to ceramide-induced endothelial cell apoptosis within the mucosal microvascular network. Ceramide generated on the surface of endothelium coalesces to form ceramide-rich platforms (CRPs) that transmit an apoptotic signal (Stancevic B., Kolesnick R. Ceramide-rich platforms in transmembrane signaling. FEBS Lett. 2010; 584 (9): 1728-1740; Haimovitz-Friedman A., et al. Ionizing radiation acts on cellular membranes to generate ceramide and initiate apoptosis. J Exp Med. 1994; 180 (2): 525-535; Verheij M., et al. Requirement for ceramide-initiated SAPK/JNK signaling in stress-induced apoptosis. Nature. 1996; 380 (6569): 75-79; Liao W. C., et al. Ataxia telangiectasia-mutated gene product inhibits DNA damage-induced apoptosis via ceramide synthase. J Biol Chem. 1999: 274 (25): 17908-17917). We have shown that CRPs are amenable to pharmacologic inactivation, specifically pharmacologic inhibition of CRP formation with an antibody to ceramide attenuated endothelial damage, enhanced crypt stem cell clonogen survival, and thereby increased tissue regeneration, even following lethal radiation doses. See Rotolo, et al., Anti-ceramide antibody prevents the radiation gastrointestinal syndrome in mice, J Clin Invest. 2012; 122(5):1786-1790, and Rotolo, et al., U.S. patent application Ser. No. 12/599,280.
In initial studies ionizing radiation (10 Gy) induced a rapid increase in BAEC ASMase enzymatic activity while concomitantly increasing cellular ceramide within 1 minute of stimulation. Simultaneous increase of neutral sphingomyelinase or ceramide synthase activity was not detected, confirming that radiation-induced ceramide generation was ASMase-mediated. Formation of ceramide-rich platforms (CRPs) was detected as early as 30 seconds after irradiation, and was dose dependent at 1 minute, reaching a maximum at 11 Gy (P<0.001), with an ED50 of approximately 5 Gy. Preincubation of BAECs with MID 15B4 (a commercially available anti-ceramide antibody), a strategy known to neutralize cell surface ceramide and block ceramide-induced coalescence in other cell types (Rotolo J. A., Zhang J., Donepudi M., Lee H., Fuks Z., Kolesnick R. Caspase-dependent and -independent activation of acid sphingomyelinase signaling. J Biol Chem. 2005; 280 (28): 26425-26434; Grassme H., et al. CD95 signaling via ceramide-rich membrane rafts. J Biol Chem. 2001; 276 (23): 20589-20596; Grassme H., et al. Host defense against Pseudomonas aeruginosa requires ceramide-rich membrane rafts. Nat Med. 2003; 9 (3): 322-330; Göggel R., et al. PAF-mediated pulmonary edema: a new role for acid sphingomyelinase and ceramide. Nat Med. 2004; 10 (2): 155-160), inhibited radiation-induced formation of CRPs at a dose range that is virtually identical to that published for induction of radiation-induced apoptosis in BAECs (Fuks Z., et al. Basic fibroblast growth factor protects endothelial cells against radiation-induced programmed cell death in vitro and in vivo. Cancer Res. 1994; 54 (10): 2582-2590.) Surface ceramide neutralization and CRP inhibition attenuated 10 Gy-induced apoptosis by 71% for up to 8 hours after stimulation.
We also reported similar anti-ceramide antibody inhibition of radiation-induced (5-20 Gy) CRP formation and apoptosis in Jurkat T lymphocytes where pre-incubation of Jurkat T cells with anti-ceramide MID15B4 (1 microgram/ml) 15 min prior to 10 Gy IR attenuated platform generation. It was also shown that sequestration of ceramide protected C57BL/6 intestinal mucosa against radiation-induced microvascular endothelial apoptosis, crypt stem cell death and lethal GI toxicity. U.S. patent application Ser. No. 12/599,280.
Our mouse monoclonal anti-ceramide IgM, termed 2A2, has specific affinity for ceramide. 2A2 inhibits CRP formation and ceramide-mediated apoptosis and dose dependently inhibited endothelial cell apoptosis in vivo. Intravenous 2A2 administration (1,000 μg/25 g mouse) to C57BL/6 mice 15 minutes prior to the LD100 of 15 Gy whole-body irradiation (WBI) reduced peak endothelial apoptosis within the lamina propria microvasculature by 83%. Thus, 2A2 phenocopies the genetic inhibition of radiation-induced intestinal endothelial apoptosis conferred by ASMase deletion in ASMase−/− mice, As little as 50 μg 2A2 antibody/25 g mouse increased the number of surviving crypts (P<0.05), while maximal protection was achieved with 1,000 μg 2A2 antibody/25 g mouse which is 40 mg/kg. 2A2 administration was without toxicity. 100% of animals receiving 2A2 were saved from radiation GI syndrome lethality at 15 Gy total body irradiation. In contrast, 100% of animals receiving irrelevant IgM (isotype control) or no antibody (vehicle only) consistently died with denuded intestinal mucosa and clinical evidence of radiation GI syndrome lethality. At the LD50 dose of 14 Gy total body irradiation, 2A2 plus hematopoietic stem cell transplant (HSCT) saved 100% of irradiated animals. Even at the very high radiation dose of 17 Gy total body irradiation, 2A2 protected 50% of GI tracts, as 25% of the 2A2-pretreated mice survived ad infinitum, and 33% of those that succumbed died with intact GI tracts. Further studies showed that HSCT did not contribute to the protective effects of 2A2.
Thus, 2A2 monoclonal antibody is prototype of a new class of anti-ceramide therapeutics (Rotolo J. A., Kolesnick R., Pasqualini R., Arap W., inventors: Sloan Kettering Institute For Cancer research, assignee. Methods for treating and preventing GI syndrome and graft versus host disease. U.S. patent application Ser. No. 12/599,280. May 6, 2008), that can be used as an effective countermeasure against the lethal radiation GI syndrome.
Recently we identified a new humanized 2A2 antibody that has even higher binding affinity for ceramide than the original mouse 2A2 antibody. Details of making this antibody and its sequence are set forth in the Examples below.
3. BACKGROUND Ceramide Signaling is Important Across Many SpeciesCeramide-mediated raft clustering is a site of signal transduction for bacteria and pathogen internalization. (D. A. Brown and E. London, Annu Rev Cell Dev Biol 14, 111 (1998); J. C. Fanzo, M. P. Lynch, H. Phee et al., Cancer Biol Ther 2 (4), 392 (2003); S. Lacour, A. Hammann, S. Grazide et al., Cancer Res 64 (10), 3593 (2004); Semac, C. Palomba, K. Kulangara et al., Cancer Res 63 (2), 534 (2003); A. B. Abdel Shakor, K. Kwiatkowska, and A. Sobota, J Biol Chem 279 (35), 36778 (2004); H. Grassme, V. Jendrossek, J. Bock et al., J Immunol 168 (1), 298 (2002); M. S. Cragg, S. M. Morgan, H. T. Chan et al., Blood 101 (3), 1045 (2003); D. Scheel-Toellner, K. Wang, L. K. Assi et al., Biochem Soc Trans 32 (Pt 5), 679 (2004); D. Delmas, C. Rebe, S. Lacour et al., J Biol Chem 278 (42), 41482 (2003); and C. Bezombes, S. Grazide, C. Garret et al., Blood 104 (4), 1166 (2004)). The unique biophysical properties of ceramide render it proficient in formation of signaling domains termed ceramide-rich platforms (CRPs) that possess a general function in signal transduction for a variety of stimuli. This theory is also supported by the fact that CRPs are formed in response to a variety of somewhat unrelated cellular stimuli (see Table 1).
CRPs mediate diverse disease pathologies. It has now been discovered that administering an anti-ceramide antibody, such as 2A2 or humanized 2A2, together with (although not necessarily simultaneously with) a broad-based antibiotic or an antibiotic targeting gram negative bacteria achieves significantly improved results in treating the enumerated diseases, compared to administering an anti-ceramide antibody alone. This new method of treatment is particularly effective in treating GI syndrome, GvHD, radiation disease and certain autoimmune diseases associated with GI damage, as well as other conditions that are also characterized by high levels of endothelial apoptosis and/or the formation of ceramide-rich platforms (CRP). Such diseases are listed in Table 2; all of these diseases are hereinafter collectively referred to as the “enumerated diseases.”
It is important to emphasize that there are multiple pathways in a cell to make ceramide in different compartments. In an earlier publication, PCT/US08/62789, corresponding to U.S. Ser. No. 12/599,280, it was shown that ASMase-generated cell surface ceramide is responsible for causing radiation GI syndrome through damage to endothelial microvasculature (a hallmark of GI syndrome). Related in vivo studies showed that inhibiting or sequestering ASMase-generated cell surface ceramide by infusing anti-ceramide antibody following lethal radiation with a lethal 15 Gy inhibited ceramide-mediated raft clustering thereby abrogating endothelial apoptosis, and enhancing crypt survival. This thereby reduced GI stem cell lethality, and enhanced overall animal survival.
PCT/US08/62789 also disclosed results showing for the first time that ASMase-generated ceramide is required for acute GvHD. GvHD, the primary complication of hematopoietic stem cell transplantation, is a unique autoimmune-like disorder arising from the differentiation and activation of alloreactive donor T cells infused into an immunoablated host. In acute GvHD, recognition of alloantigens (major or minor mismatched) of the host by donor T cells initiates an adaptive immune response including incipient damage to host tissue and Type I cytokine (IFN-gamma and IL-2) generation. This results in CTL clonal expansion and activation, that along with a developing macrophage-dependent “cytokine storm” comprised of inflammatory cytokines (TNF-α. and IL-1β) induces apoptosis in a select set of target cells and consequent damage to associated target organs (liver, intestines and skin) (D. A. Wall, supra; G. F. Murphy, D. Whitaker, J. Sprent et al., Am J Pathol 138 (4), 983 (1991); D. A. Wall and K. C. Sheehan, Transplantation 57 (2), 273 (1994); G. R. Hill, W. Krenger, and J. L. Ferrara, Cytokines Cell Mol Ther 3 (4), 257 (1997); J. L. Ferrara, Bone Marrow Transplant 21 Suppl 3, S13 (1998); A. C. Gilliam, D. Whitaker-Menezes, R. Korngold et al., J Invest Dermatol 107 (3), 377 (1996)).
High-dose chemotherapy and radiation used in the treatment of many types of leukemia and lymphomas additionally kills rapidly dividing bone marrow stem cells, resulting in immunoablation and necessitating reconstitution of hematopoietic elements. GvHD is the major complication associated with such hematopoietic stem cell transplantation in cancer patients. PCT/US08/62789 also explains that ASMase-generated ceramide is required for acute GvHD and other T cell-mediated autoimmune diseases associated with an increase in pro-inflammatory cytokines, which diseases could be also be treated by the methods and compositions described herein
There is a common thread of a requirement for ASMase-generated ceramide for radiation-induced lethality, GI syndrome, acute GvHD, and other T cell-mediated autoimmune diseases. In the studies described here, radiation lethality was used as a model for treating all of these diseases. Radiation GI Syndrome is the best defined GI pathology because it is rapid, highly reproducible and has a predictive in vivo assay, the Clonogenic Assay of Withers and Elkind, which defines the stem cell clonogenic response to injury in detail. GvHD and the Radiation GI Syndrome represent disease processes involving ASMase-mediated damage to the endothelial compartment coupled to the epithelial compartment (although the mechanism of activating ASMase differs between the two). In all of the radiation experiments described in
As is shown in
In a third experiment, both isolated and purified monoclonal 2A2 Ab and Baytril (3 mg/per animal per day) were administered 24 hours following irradiation. The results showed that this combination anti-ceramide antibody/antibiotic treatment had a synergistic effect in mitigating/treating GI Syndrome in irradiated mice. Without treatment, 100% of untreated mice died by day 6 post-irradiation. However, 75% of the mice treated with the 2A2 Ab and Baytril combination therapy survived for the duration of the study, an increase of more than 3 fold the survival achieved with either 2A2 or antibiotic alone.
Based on these results certain embodiments of the invention are directed to a method for preventing or treating or preventing an enumerated disease (GvHD, radiation disease, GI syndrome and certain autoimmune diseases) in an animal, by administering a therapeutically effective amount of an anti-ceramide antibody and either Baytril (or other quinolone antibiotic), or combinations of antibiotics selected from Table 1 or any broad spectrum antibiotic that is effective against Gram-negative antibiotic. The prophylactic and therapeutic agents described herein for combination therapy can be administered on the same or on consecutive days and they can be administered before or after radiation or graft transplant. Where treatment is not begun before radiation or transplantation, for example, therapy should be initiated as soon as possible after the enumerated disease is suspected or diagnosed. For mitigation of radiation disease, GI Syndrome, or GvHD, therapeutic agents should be delivered within either before radiation or transplantation or within the first 24 hours following radiation exposure or transplantation.
Antibiotics other than the quinolones are also expected to have a synergistic effect when administered together with an anti-ceramide antibody, and this can be tested using routine experimentation. Antibiotics that can be used in embodiments of the invention include quinolones (Baytril, ciprofloxacin), cephalosporins (cefepime, ceftazidine) or aminoglycosides (gentamicin, amikacin) that are therapeutically effective in mitigating radiation diseases like GI syndrome. Brook I, Elliot T B, Ledney G D, Shomaker M O, Knudson G B. Management of post-irradiation infection: lessons learned from animal models. Mil Med. 2004; 169:194-7.
Routine experimentation will determine the optimal therapeutically effective amount of antibiotic and anti-ceramide antibody to use. Prophylactically and therapeutically effective amounts of both the anti-ceramide antibody and the antibiotic are from about 0.1 mg/kg to about 100 mg/kg and from about 100 mg/kg to about 1000 mg/kg.
Fully human or humanized antibodies are preferred for a human subject. For antibodies, a therapeutic or prophylactic amount typically varies and can be an amount sufficient to achieve serum therapeutic agent levels typically of between about 1 microgram per milliliter and about 10 micrograms per milliliter in the subject. As is shown below, preincubation of Jurkat cells with 2A2 monoclonal anti-ceramide antibody (25-100 micrograms/mL) inhibited 8 Gy-induced apoptosis. In the context of the present invention, anti-ceramide antibodies are a type of neutralizing antibody that prevents ceramide-induced apoptosis. In addition to the monoclonal anti-ceramide antibody 2A2, we previously reported three other isotypes of monoclonal anti-ceramide antibodies, including 15D9 mAb, which is IgM, κ; and 1H4 and 5H9 mAbs, which are IgG3, κ antibodies (described in detail in published U.S. application Ser. No. 12/599,280; 2010/0239572). Any anti-ceramide antibody can be used in the present invention, including mono- and poly-clonal antibodies, and biologically active fragments or variants thereof.
The optimal therapeutic dose of an antibiotic can be determined with routine experimentation with guidance from the literature on treating radiation disease, GvHD and related symptoms. The management of established or suspected infection following exposure to radiation (characterized by neutropenia and fever) has been described. The patient that develops neutropenia after radiation is susceptible to irradiation damage to other tissues, such as the gastrointestinal tract, lungs and the central nervous system. These patients are typically treated with broad-spectrum empirical therapy with high doses of one or more of the enumerated antibiotics as soon as possible even before symptoms appear, but at least once fever is detected. The prophylactic and therapeutic amounts of the antibiotics administered to treat or prevent post-radiation GI damage are well known in the art and can be applied to embodiments of the present methods. Donnelly E H, Nemhauser J B, Smith J M, et al. (June 2010). “Acute radiation syndrome: assessment and management” South. Med. J. 103(6): 541-PMID2071013; Baranov A E, Rozhdestvenskii L M, Radiats Biol Radioecol. PMID: 18689253, 2008 May-June; 48(3):287-302, The analytical review of the schemes of the acute radiation disease treatment used in experiment and in clinic; Brook I, Ledney D (1992). “Quinolone therapy in the management of infection after irradiation” Crit Rev Microbiol: 18235-46. The above-described antimicrobials include those that target Gram-negative aerobic organisms (i.e. Enterobacteriacae, Pseudomonas) that account for more than three-fourths of the isolates causing sepsis. Aerobic and facultative Gram-positive bacteria (mostly alpha-hemolytic streptococci) cause sepsis in about a quarter of the victims.
Quinolone antibiotics include Ciprofloxacin (Cipro, Proquin and others) Enoxacin (Penetrex and others) Gatifloxacin (Gatiflo, Tequin, Zymar and others) Gemifloxacin (Factive and others) Levofloxacin (Levaquin and others) Lomefloxacin (Maxaquin and others) Moxifloxacin (Avelox and others) Norfloxacin (Noroxin and others) Ofloxacin (Floxin and others) Prulifloxacin Sparfloxacin (Zagam and others) Trovafloxacin/Altrofloxacin (Trovan and others) Danofloxacin (A180 and others) Difloxacin (Dicural and others) Marbofloxacin (Orbax and others) Orbifloxacin (Zeniquin and others) Quinolones (older ‘parent’ class) Naldixic acid (NegGram and others) Cinoxacin (Cinobac and others)
Previous work also showed that statins (e.g., nystatin) had beneficial effects in reducing apoptosis in in vitro models of GvHD. Therefore certain other embodiments of the invention are directed to combination therapies of anti-ceramide antibody and antibiotics together with one or more statins. A description of statins for treating apoptosis is set forth in U.S. Ser. No. 12/599,280. The statins include, in alphabetical order (brand names vary in different countries)
In yet other embodiments, the ASMase inhibitor imipramine is included in the combination therapy. In U.S. Ser. No. 12/599,280 it was shown that ASMase-generated ceramide is required for both endothelial microvasculature damage and T-cell mediated killing. Inhibiting or sequestering ceramide generated by ASMase by administering anti-ceramide antibodies in vivo, reduced radiation-induced damage, and can be used to treat or prevent GI syndrome and GvHD. ASMase can be blocked with imipramine. In another embodiment antisense nucleic acids are administered together with antibiotics and anti-ceramide antibodies. Data supporting the inhibition of ASMase with imipramine or antisense nucleic acids was published in The Journal of Biological Chemistry (2005), 280, 26425-26434.
h2A2 Antibodies
The humanization of the mouse 2A2 antibody is described in the Examples below. ELISA experiments revealed that h2A2 binds preferentially to ceramide (
Increasing doses of h2A2 (50-1000 micrograms/mouse) were administered to C57BL/6 mice 15 minutes prior to 15 Gy total body irradiation. Direct comparison of the efficacy of h2A2 vs. m2A2 on surviving crypts indicated that h2A2 is equally effective as m2A2 as a prophylactic for the RGS.
C57BL/6 mice exposed to 16 Gy sub-total body irradiation, were administered h2A2 15 minutes prior to radiation exposure, and survival was followed. 100% of animals treated with h2A2 survived at least 15 days while 100% of untreated animals died by day 8 post exposure, each dying with autopsy confirmed denudation of the GI mucosa and collapse of the crypt-villus units.
Certain embodiments are directed to pharmaceutical formulations of the enumerated antibiotics and antibodies in therapeutically or prophylactically effective amounts sufficient to prevent or treat the enumerated diseases in a subject. These pharmaceutical compositions are suitable for administration to a subject in need of prophylaxis or therapy. The subject is preferably a human but can be non-human as well. A suitable subject can be an individual who is suspected of having, has been diagnosed as having, or is at risk of developing one of the enumerated diseases. For the prevention or treatment of disease, the appropriate dosage of antibody and antibiotic will depend on the type of disease to be treated, the severity and course of the disease, whether the drug is administered for preventive or therapeutic purposes, previous therapy, the route of administration, the pharmacokinetics of the agent, the patient's clinical history and response to the new drugs (2A2 antibody, etc.) and the discretion of the attending physician.
As mentioned above, the amount of anti-ceramide antibody to be administered ranges from about 0.1 mg/kg to about 1000 mg/kg and the typical amount of antibiotic ranges from about 0.1 mg/kg to 1000 mg/kg. This amount typically varies and can be an amount sufficient to achieve serum therapeutic agent levels for each therapeutic agent that are typically of between about 1 microgram per milliliter and about 10 micrograms per milliliter in the subject. However, serum levels that elicit the desired response will vary. The therapeutic agents of the invention can be administered by one or more separate administrations, or by continuous infusion. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until the symptoms are sufficiently reduced or eliminated. The progress of this therapy is easily monitored by conventional techniques and assays, and may be used to adjust dosage to achieve a therapeutic effect.
Therapeutic compositions may contain, for example, such normally employed additives as binders, fillers, carriers, preservatives, stabilizing agents, emulsifiers, buffers and excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, cellulose, magnesium carbonate, and the like. These compositions typically contain 1%-95% of active ingredient, preferably 2%-70% active ingredient. The formulations may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. Such molecules are suitably present in combination in amounts that are effective for the purpose intended. For example, the 2A2 antibody and the antibiotic combinations could be formulated to further include a statin or imipramine.
Sustained-release preparations may also be prepared. Suitable examples of sustained release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibodies or fragments, nystatin, imipramine or combinations thereof, which matrices are in the form of shaped articles, e.g., films, or microcapsule. Examples of sustained release matrices include, but are not limited to, polyesters, hydrogels (for example, poly (2-hydroxyethyl-methacrylate), or poly (vinyl alcohol)), polylactides, copolymers of L-glutamic acid and y ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(−)-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
The therapeutic agents may be present in the pharmaceutical compositions in the form of salts of pharmaceutically acceptable acids or in the form of bases or in amorphous form or in crystalline forms, including hydrates and solvates. Pharmaceutically acceptable salts of the therapeutic agents described herein include those salts derived from pharmaceutically acceptable inorganic and organic acids and bases. Examples of suitable acid salts include acetate, adipate, alginate, aspartate, benzoate, benzenesulfonate, bisulfate, butyrate, citrate, camphorate, camphorsulfonate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptanoate, glycerophosphate, glycolate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, 2-hydroxyethanesulfonate, lactate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oxalate, palmoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, salicylate, succinate, sulfate, tartrate, thiocyanate, tosylate and undecanoate salts. Other acids, such as oxalic, while not in themselves pharmaceutically acceptable, may be employed in the preparation of salts useful as intermediates in obtaining pharmaceutically acceptable acid addition salts. Salts derived from appropriate bases include alkali metal (e.g., sodium and potassium), alkaline earth metal (e.g., magnesium), ammonium and N+(C1-4 alkyl)4 salts. It is anticipated that some embodiment include the quaternization of any basic nitrogen-containing groups of the therapeutic agents disclosed herein. Water or oil-soluble or dispersible products may be obtained by such quaternization.
The therapeutic agents include all stereochemical forms of the therapeutic agents (i.e., the R and S configurations for each asymmetric center). Therefore, single enantiomers, racemic mixtures, and diastereomers of the therapeutic agents are within the scope of the invention. Also within the scope of the invention are steric isomers and positional isomers of the therapeutic agents. The therapeutic agents of some embodiments are also meant to include compounds which differ only in the presence of one or more isotopically enriched atoms. For example, therapeutic agents in which one or more hydrogen are replaced by deuterium or tritium, or the replacement of one or more carbons by 13C- or 14C-enriched carbon are within the scope of this invention.
The therapeutic agents of some embodiments are administered in a pharmaceutical composition that includes a pharmaceutically acceptable carrier, adjuvant, or vehicle. The term “pharmaceutically acceptable carrier, adjuvant, or vehicle” refers to a non-toxic carrier, adjuvant, or vehicle that does not destroy or significantly diminish the pharmacological activity of the therapeutic agent with which it is formulated. Pharmaceutically acceptable carriers, adjuvants or vehicles encompass any of the standard pharmaceutically accepted liquid carriers, such as a phosphate-buffered saline solution, water, as well as emulsions such as an oil/water emulsion or a triglyceride emulsion. Solid carriers may include excipients such as starch, milk, sugar, certain types of clay, stearic acid, talc, gums, glycols, or other known excipients. Carriers may also include flavor and color additives or other ingredients. The formulations of the combination of some embodiments may be prepared by methods well-known in the pharmaceutical arts and described herein. Exemplary acceptable pharmaceutical carriers have been discussed above.
The pharmaceutical compositions are preferably formulated for IV, intramuscular or subcutaneous administration. When antibiotics are administered separately from the antibody, it may be administered by any route known in the art for administering antibiotics, including oral administration.
These suspensions may be formulated according to techniques known in the art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium.
Orally acceptable dosage forms (which are suitable for antibiotics administered separately from the antibodies), include solid forms such as capsules and tablets. Pharmaceutically compatible binding agents, and/or adjuvant materials can be comprised as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
Solutions or suspensions used for parenteral, intradermal, IV, IM or subcutaneous application can comprise the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
Pharmaceutical compositions suitable for injection comprise sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. For intravenous administration, suitable carriers comprise physiological saline, bacteriostatic water, Cremophor EL.™ (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the selected particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In some cases, isotonic agents are included in the composition, for example, sugars, polyalcohols such as manitol, sorbitol, or sodium chloride. Prolonged absorption of an injectable composition can be achieved by including in the composition an agent that delays absorption, for example, aluminum monostearate or gelatin.
Sterile injectable solutions can be prepared by incorporating the active compound in the specified amount in an appropriate solvent with one or a combination of ingredients enumerated above, as needed, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and other ingredients selected from those enumerated above or others known in the art. In the case of sterile powders for the preparation of sterile injectable solutions, the methods of preparation comprise vacuum drying and freeze-drying which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
The compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
Biologically Active Fragments and Variants“Biologically active fragments” of an anti-ceramide antibody as used herein, mean any fragment that retains binding affinity for ceramide. The fragments retain one or more CDR regions from the original antibody. CDRs are the sites of the antibody that bind to the antigen (i.e., in the present case ceramide) and in most cases are unique to that antibody. In order for a fragment to retain binding to the antigen, it would need to have at least one of these CDRs. Biologically active fragments may also contain minor variations provided that the variations in the amino acid sequence maintain at least 75%, more preferably at least 80%, 90%, 95%, and most preferably 99% sequence identity and the molecule retains its affinity for binding to ceramide.
“Variants” of an anti-ceramide antibody or fragment thereof include amino acid sequence modification(s) of the antibodies described herein that may, for example, improve the binding affinity and/or other biological properties of the antibody for the intended purpose of treating or mitigating an enumerated disease. Amino acid sequence variants of the antibody may be prepared by introducing appropriate changes into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired affinity for ceramide. The amino acid alterations may be introduced in the subject antibody amino acid sequence at the time that sequence is made.
AntibodiesAn “antibody” refers to an intact immunoglobulin or to an antigen-binding portion thereof that competes with the intact antibody for specific binding. Antigen-binding portions may be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies. The term “recombinant human antibody”, as used herein, is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes, (b) antibodies expressed using a recombinant expression vector transfected into a host cell, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (c) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences. Such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo Antigen-binding portions include, inter alia, Fab, Fab′, F(ab′)2, Fv, dAb, and complementarity determining region (CDR) fragments, single-chain antibodies (scFv), chimeric antibodies, diabodies and polypeptides that contain at least a portion of an immunoglobulin that is sufficient to confer specific antigen binding to the target ceramide Also included in the definition of antibodies is the SuperAntibody including those chemically conjugated to T15 peptide or genetically-engineered into a human IgG1 backbone (see Y. Zhao, D. Lou, J. Burkett and H. Kohler. Enhanced Anti-B-cell Tumor Effects with Anti-CD20 SuperAntibody. J Immunotherapy, 25: 57-62, 2002. The immunoglobulin subtype can be any subtype; typically IgG and IgM are used, but IgA, IgE etc. may also be effective.
An “immunoglobulin” is a tetrameric molecule. In a naturally-occurring immunoglobulin, each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as κ and λ light chains. Heavy chains are classified as M, δ, γ, α or ε, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
The variable regions of each light/heavy chain pair form the antibody binding site such that an intact immunoglobulin has two binding sites. Immunoglobulin chains exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarity determining regions or CDRs. The CDRs from the two chains of each pair are aligned by the framework regions, enabling binding to a specific epitope. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)). The term “epitope” means a determinant capable of specific binding to an antibody. Epitopes typically consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents. From N-terminus to C-terminus, both light and heavy chains comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991), or Chothia & Lesk J. Mol. Biol. 196:901 917 (1987); Chothia et al., Nature 342:878 883 (1989)).
The term “human antibody”, as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences. The human antibodies of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo). However, the term “human antibody”, as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences The terms “monoclonal antibody” or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope. Accordingly, the term “human monoclonal antibody” refers to antibodies displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences. In one embodiment, the human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell. Monoclonal antibodies for use in the embodiments of the present invention are described below.
An Fab fragment is a monovalent fragment consisting of the VL, VH, CL and CH I domains; a F(ab′)2 fragment is a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consists of the VH and CH1 domains; an Fv fragment consists of the VL and VH domains of a single arm of an antibody; and a dAb fragment (Ward et al., Nature 341:544 546, 1989) consists of a VH domain. A single-chain antibody (scFv) is an antibody in which a VL and VH regions are paired to form a monovalent molecules via a synthetic linker that enables them to be made as a single protein chain (Bird et al., Science 242:423 426, 1988 and Huston et al., Proc. Natl. Acad. Sci. USA 85:5879 5883, 1988). Diabodies are bivalent, bispecific antibodies in which VH and VL domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (see e.g., Holliger, P., et al., Proc. Natl. Acad. Sci. USA 90:6444 6448, 1993, and Poljak, R. J., et al., Structure 2:1121 1123, 1994). One or more CDRs may be incorporated into a molecule either covalently or noncovalently to make it bispecific. Bispecific antibodies may also be used that have one combining site from an anti-ceramide antibody and a second site directed to a second antigen to improve targeting to T-cells etc. An immunoadhesin may incorporate the CDR(s) as part of a larger polypeptide chain, may covalently link the CDR(s) to another polypeptide chain, or may incorporate the CDR(s) noncovalently. The CDRs permit the immunoadhesin to specifically bind to a particular antigen of interest.
An antibody may have one or more binding sites. If there is more than one binding site, the binding sites may be identical to one another or may be different. For instance, a naturally-occurring immunoglobulin has two identical binding sites, a single-chain antibody or Fab fragment has one binding site, while a “bispecific” or “bifunctional” antibody has two different binding sites.
An “isolated antibody” is an antibody that (1) is not associated with naturally-associated components, including other naturally-associated antibodies, that accompany it in its native state, (2) is free of other proteins from the same species, (3) is expressed by a cell from a different species, or (4) does not occur in nature. An “isolated antibody,” as used herein, is intended to refer to an antibody which is substantially free of other antibodies having different antigenic specificities. Moreover, an isolated antibody may be substantially free of other cellular material and/or chemicals. In one embodiment of the invention, a combination of “isolated” anti-ceramide antibodies having different specificities is combined in a well-defined composition. The embodiments of the invention use isolated antibodies.
The terms “human antibody” or “humanized antibody” includes all antibodies that have one or more variable and constant regions derived from human immunoglobulin sequences. Humanized antibodies are preferred for treating humans. A humanized antibody is one that is derived from a non-human species, in which certain amino acids in the framework and constant domains of the heavy and light chains have been mutated so as to avoid or abrogate an immune response in humans. Alternatively, a humanized antibody may be produced by fusing the constant domains from a human antibody to the variable domains of a non-human species. Examples of how to make humanized antibodies may be found in U.S. Pat. Nos. 6,054,297, 5,886,152 and 5,877,293. Methods for making the h2A2 antibody are found in the Examples.
The term “chimeric antibody” refers to an antibody that contains one or more regions from one antibody and one or more regions from one or more other antibodies.
Fragments or analogs of antibodies can be readily prepared by those of ordinary skill in the art following the teachings of this specification. Preferred amino- and carboxy-termini of fragments or analogs occur near boundaries of functional domains. Structural and functional domains can be identified by comparison of the nucleotide and/or amino acid sequence data to public or proprietary sequence databases. Preferably, computerized comparison methods are used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function. Methods to identify protein sequences that fold into a known three-dimensional structure are known. Bowie et al. Science 253:164 (1991).
Anti-Ceramide Monoclonal IgM AntibodyA flow chart of the strategy used to generate novel anti-ceramide antibodies with potent in vivo activity is shown in
Purified monoclonal 2A2 antibody was isolated from supernatant #3673. ELISA revealed that the 2A2 mouse monoclonal IgM bound to BSA-ceramide. ELISA showed significantly more binding capacity of 2A2 vs. control IgM. Methods for humanizing the antibody and others are set forth in Example 1.
Certain other embodiments are directed to a composition comprising an anti-ceramide antibody, preferably humanized, such as h2A2, and an enumerated antibiotic such as a quinolone antibiotic. In other embodiments the Antibody/Antibiotic compositions optionally include (1) a statin in an amount that decreases circulating cholesterol levels thereby increasing the efficacy of the anti-ceramide antibody and/or (2) imipramine, an ASMase inhibitor presently used as an antidepressive agent. In some methods and compositions a mimotope that elicits an immune response in the subject causing the subject to form anti-ceramide antibodies, is used along with or instead of an anti-ceramide antibody.
Other monoclonal antibodies, made in mice that were immunized with BSA-ceramide, showed dose-dependent protective effects comparable to those of 2A2 when screened in a Jurkat cell apoptosis inhibition assay. These include 15D9, which is IgM, and 1H4 and 5H9 mAbs, which are IgG3, K.
Immunizing the host mice with Kaposi sarcoma cells generated effective anti-ceramide monoclonal antibodies with dramatic therapeutic effects as shown for example with the 2A2 antibody.
5. EXAMPLES Example 1: Materials & MethodsThe lethality of GI stem cell clonogens is best assessed by the number of crypts surviving at 3.5 days after radiation exposure, which decreases exponentially as the dose increases (C. S. Potten and M. Loeffler, Development 110 (4), 1001 (1990), H. R. Withers, Cancer 28 (1), 75 (1971), and J. G. Maj, F. Paris, A. Haimovitz-Friedman et al., Cancer Res 63, 4338 (2003)). Crypts that contain surviving stem cells proliferate at an accelerated rate, producing typical regenerative crypts that split or bud to generate new crypts, until the intestinal mucosa regains a normal architecture. Total body irradiation (TBI) experiments in several mouse models have demonstrated that the number of surviving crypt stem cells after exposure to 8-12 Gy is usually sufficient to support a complete recovery of the mucosa. At higher doses, however, massive stem cell clonogen loss may lead to a near total collapse of the crypt-villus system, mucosal denudation and animal death from the GI syndrome. Autopsy studies of C57BL/6 mice exposed to TBI revealed that 25% of the mice exposed to 14 Gy and 100% of those exposed 15 Gy succumbed to the GI syndrome at 6.8.+/−.0.99 days, predicting an LD50 for GI death between 14 and 15 Gy. A dose of 15 Gy was used in the experiments described herein. Subtotal was used for survival studies, as described in the next paragraph
Male C57BL/6 mice (6-8 weeks old) were placed in a ventilated Plexiglas restrainer with head/forepaws and hind legs/tail covered by lead shield, and exposed to 15.5 Gy or 16 Gy subtotal body irradiation (SBI) (Philips MG-324 X-ray unit at a dose rate of 118.3 cGy/min, 50 cm source to skin distance). Purified 2A2 IgM (1000 μg) was administered by intravenous tail-vein injection 24 hours following irradiation. Beginning 24 hours following exposure, mice were given free access to drinking water containing 0.57 mg/ml Baytril, a flouroquinolone with demonstrated efficacy against both Gram-negative and Gram-positive bacteria in both stationary and growth phases of bacterial replication. Based upon the estimation of 6 ml of drinking water consumed daily by 25 g C57BL/6 mice, daily Baytril consumption is estimated at 3 mg/day.
Radiation and Tissue PreparationTBI (total body irradiation) was used only for protection studies, SBI for mitigation studies was delivered with a Shepherd Mark-I unit (Model 68, SN643) operating 137Cs sources. The dose rate was 2.12 Gy/min. To collect small intestinal samples, mice were sacrificed by hypercapnia asphyxiation, and 2.5 cm segments of the proximal jejunum were obtained at 2 cm from the ligament of Trietz. Tissue samples were fixed by overnight incubation in 4% neutral buffered formaldehyde and embedded in paraffin blocks. To evaluate intestinal tissue responses to radiation, transverse sections of the full jejunal circumference (5 micrometers thick) were obtained by microtomy from the paraffin blocks, adhered to polylysine-treated slides and deparaffinized by heating at 90 degrees Celsius for 10 minutes and at 60 degrees Celsius for 5 minutes, followed by two xylene washes for 5 minutes, and stained with hematoxylin and eosin according to a standard protocol. To determine the causes of death after TBI, autopsies were performed within 60 min of animal death or when terminally-sick animals displaying an agonal breathing pattern were sacrificed by hypercapnia asphyxiation. Tissue specimens were collected from all animals, fixed in formaldehyde, and stained with hematoxylin.
Survival of Mice after Irradiation and Designation of Autopsy Findings.
Actuarial survival of animals was calculated by the product limit Kaplan-Meier method. Terminally sick animals displaying an agonal breathing pattern were sacrificed by hypercapnia asphyxiation and evaluated by necropsy to determine cause of death. Intestinal specimens were fixed in formaldehyde, and stained with hematoxylin. GI damage can be diagnosed as the cause of death when the small intestines display denuded mucosa with nearly no villae or crypts apparent or when the mucosa display limited mucosal repair (Kaplan, E. L. and P. Meier, Nonparametic estimation from incomplete observations. J of the American Statistical Association, 1958. 53: p. 457-48; Rotolo, J. A., et al., Bax and Bak do not exhibit functional redundancy in mediating radiation endothelial apoptosis in the intestinal mucosa. Int J Radiat Oncol Biol Phys, 2008. 70(3): p. 804-15).
Example 2 Methods for Making Humanized 2A2 AntibodyMethods for making monoclonal mouse 2A2 Antibody are described in PCT/US08/62789.
Humanization of 2A2 was performed to generate a humanized 2A2 (h2A2) monoclonal antibody by the CDR grafting method. Usually, rodent antibodies can be immunogenic to human and cause very serious side effects including the HAMA (human anti-mouse antibodies) response or anaphylactic shock. With this CDR grafting approach, CDR loops that make up the antigen-binding site of the mouse Mab are grafted into corresponding human framework regions. Initially, the variable light and heavy chain sequences of m2A2 were determined. To do so, m2A2 hybridoma cells were harvested by centrifugation and total RNA was extracted from cells. Total RNA was used for cDNA synthesis, and V-region genes of 2A2 were isolated using standard primer sets.
To identify human VL and VH homologous to those of 2A2, the variable regions of 2A2 were compared with variable regions of human germline sequences using the VBASE online database. As a result, two human germline VL and VH sequences were found. The following sequences are variable heavy (VH) and light chain (VL) of mouse 2A2, human germline sequences, and homologous regions of these mouse and human sequences:
The selected 2A2 VH sequence was found to be most homologous to the human V gene 1-46 from the VH1 family and human J gene JH6. The selected 2A2 VL sequence was found to be most homologous with the human V gene A1 from the Vk2 family and human J gene Jk2. m2A2 CDR sequences were grafted into these VL and VH, such that the synthesized sequences each contained three mouse CDRs in the selected human framework sequences. As 2A2 Mab is originally a murine IgM, the h2A2 Mab was converted to the IgG1 format. IgG1 Mabs have many benefits over IgM, including that IgG1 is the most abundant Mab in serum (9 mg/ml), its half-life (21 days) is longer than any other antibody, and, currently, many commercial therapeutic antibodies are IgG1 format. To construct humanized 2A2 IgG1 in a mammalian expression vector, pOptiVEC and pcDNA 3.3 (Invitrogen) vectors were used. The following is a brief vector map.
The vector contains the human cytomegalovirus (CMV) immediate-early promoter/enhancer for high-level expression of recombinant proteins in a wide range of mammalian cells. The human variable light and heavy chains containing the three CDRs of mouse 2A2 were synthesized and linked to the human constant light and heavy chain by PCR. The humanized 2A2 light chain was cloned into pcDNA3.3 TOPO, and humanized 2A2 heavy chain was cloned into the pOptiVEC TOPO antibody expression vector. Sequences of human 2A2 IgG1 have be shown below. The first amino acid (Arginine, red color shading) of human constant light chain was deleted during construction of whole humanized light chain. After construction of these human 2A2 Ab expression vectors, the DNA plasmids were co-transfected into CHO-derived, DHFR-negative DG44 cells to create a stable cell line that produces 2A2 hIgG1 antibody.
To obtain cell lines that produce high levels of antibody, a pool of stably-transfected cells were selected by performing two rounds of selection using CD OptiCHO medium and CD OptiCHO medium with 500 μg/ml of Geneticine, followed by MTX genomic amplification selection and two rounds of single cell clonal selection in semi-solid media in a 96-well plate. Antibody expression levels were screened by ELISA assay quantification and selected h2A2IgG1-CHO cell (G3A10, C5G6 and D5F11) lines were slowly scaled up.
In vitro production of h2A2 IgG1 recombinant antibody was performed in OptiCHO serum free media using a hollow fiber bioreactor. Expansion of this clone allowed bulk-production and purification of h2A2 IgG1 in the hollow-fiber system. Purification of recombinant IgG from concentrated harvest was performed using standard Protein-A/G affinity chromatography. Antibody was eluted, buffer exchange was performed and antibody in phosphate-buffered saline was frozen in aliquots at a concentration of 3 mg/ml for further analysis. To date, we have purified over 50 milligrams of recombinant h2A2 for evaluation in vitro and in vivo.
To confirm the binding affinity of h2A2 to ceramide, performed a series of ELISA assays were performed using C16 ceramide covalently bound to either bovine serum albumin (BSA) or ovalbumin (OVA) via a linkage at the terminal end of the fatty acid subunit of ceramide. Briefly, h2A2 was biotinylated, and antibody binding to microplates coated with BSA- or OVA-conjugated C16 ceramide was determined using horse-radish peroxidase labeled streptavidin. Experiments revealed that h2A2 bound C16 ceramide in a dose-dependent manner.
Claims
1.-9. (canceled)
10. An anti-ceramide antibody or antigen-binding fragment thereof, comprising a variable heavy chain (VH) and a variable light chain (VL), QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYWMHWVRQAPGQGLEWMGA IYPGDSDTSYNQKFKGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARLY YGYDWGQGTTVTVSS.
- wherein the VH comprises a VH-CDR1 sequence of NYWMH, a VH-CDR2 sequence of AIYPGDSDTSYNQKFKG, and a VH-CDR3 sequence of LYYGYD, and
- wherein the VL comprises a VL-CDR1 sequence of KSSQSLIDSDGKTFLNW, a VL-CDR2 sequence of LVSKLDS, and a VL-CDR3 sequence of WQGTHFPYT; wherein the VH comprises
11. The anti-ceramide antibody or antigen-binding fragment thereof according to claim 10, wherein the VL comprises DVVMTQSPLSLPVTLGQPASISCKSSQSLIDSDGKTFLNWFQQRPGQSPR RLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGTHFP YTFGQGTKLEIK.
12. The anti-ceramide antibody or antigen-binding fragment thereof according to claim 10, wherein the antibody is an IgG antibody.
13. The anti-ceramide antibody or antigen-binding fragment thereof according to claim 12, wherein the antibody is an IgG1 antibody.
14. The anti-ceramide antibody or antigen-binding fragment thereof according to claim 10, wherein the antibody is an IgM antibody.
15. The anti-ceramide antibody or antigen-binding fragment thereof according to claim 10, wherein the antigen-binding fragment is a scFv.
16. The anti-ceramide antibody or antigen-binding fragment thereof according to claim 10, comprising a heavy chain comprising QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYWMHWVRQAPGQGLEWMGA IYPGDSDTSYNQKFKGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARLY YGYDWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV NHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG.
17. The anti-ceramide antibody or antigen-binding fragment thereof according to claim 10, comprising a light chain comprising DVVMTQSPLSLPVTLGQPASISCKSSQSLIDSDGKTFLNWFQQRPGQSPR RLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGTHFP YTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC.
18. The anti-ceramide antibody or antigen-binding fragment thereof according to claim 10, comprising a heavy chain according to SEQ ID NO: 6.
19. The anti-ceramide antibody according to claim 10, comprising a light chain according to SEQ ID NO: 8.
20. An anti-ceramide antibody or antigen-binding fragment thereof, comprising a variable heavy chain (VH) and a variable light chain (VL), DVVMTQSPLSLPVTLGQPASISCKSSQSLIDSDGKTFLNMTQQRPGQSPR RLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGTHFP YTFGQGTKLEIK.
- wherein the VH comprises a VH-CDR1 sequence of NYWMH, a VH-CDR2 sequence of AIYPGDSDTSYNQKFKG, and a VH-CDR3 sequence of LYYGYD, and
- wherein the VL comprises a VL-CDR1 sequence of KSSQSLIDSDGKTFLNW, a VL-CDR2 sequence of LVSKLDS, and a VL-CDR3 sequence of WQGTHFPYT; wherein the VL comprises
Type: Application
Filed: Jul 17, 2020
Publication Date: Apr 21, 2022
Applicant:
Inventors: Jimmy Andrew ROTOLO (Port Washington, NY), Richard N. KOLESNICK (New York, NY)
Application Number: 16/932,204