FUSION PROTEINS FOR DELIVERY OF GDNF TO THE CNS
The invention provides compositions, methods, and kits for increasing transport of GDNF across the blood brain barrier while allowing its activity to remain substantially intact. The GDNF is transported across the blood brain barrier via one or more endogenous receptor-mediated transport systems.
This application is a continuation of U.S. patent application Ser. No. 16/828,557, filed Mar. 24, 2020, which is a continuation of U.S. patent application Ser. No. 14/144,460, filed Dec. 30, 2013, now abandoned, which is a continuation of U.S. patent application Ser. No. 12/323,232 filed Nov. 25, 2008, now U.S. Pat. No. 8,741,260, issued Jun. 3, 2014, which is a continuation-in-part of U.S. patent application Ser. No. 11/245,546 filed Oct. 7, 2005, now U.S. Pat. No. 8,142,781, issued Mar. 27, 2012, and which claims the benefit of U.S. Provisional Patent Application Ser. No. 60/990,290 filed Nov. 26, 2007, the contents of which are incorporated herein by reference in their entirety.
SEQUENCE LISTINGThe instant application contains a Sequence Listing which has been submitted electronically in XML, format and is hereby incorporated by reference in its entirety. Said XML copy, created on Jul. 11, 2022, is named 28570-706_303_SL.xml and is 97,000 bytes in size.
BACKGROUND OF THE INVENTIONNeurological disorders represent a major cause of mortality and disability worldwide. Despite extensive progress, current treatment options remain limited in some aspects. One major reason for this limitation is that the brain is unique in allowing only select access to molecules. While this is a useful protective mechanism, it also means that many potentially beneficial molecular entities do not have access to the central nervous system (CNS), and thus are unable to exert a therapeutic effect in many neurological disorders or other conditions of the CNS. The present invention represents an advance in providing accessibility of the CNS for molecular entities whose ability to cross the blood brain barrier is limited.
SUMMARY OF THE INVENTIONIn one aspect, the invention provides a composition comprising a neurotherapeutic peptide comprising an amino acid sequence which is at least 80% (e.g., 95%) identical to the amino acid sequence of mature human GDNF (SEQ ID NO:52) covalently linked to a structure that is capable of crossing the blood brain barrier (BBB) (e.g., an antibody). In some embodiments, the structure that is capable of crossing the BBB crosses the BBB on an endogenous BBB receptor. In some embodiments, the endogenous BBB receptor is the insulin receptor, transferrin receptor, leptin receptor, lipoprotein receptor, and the IGF receptor. In some embodiments, the structure that is capable of crossing the BBB is a monoclonal antibody. In some embodiments, the monoclonal antibody is a chimeric monoclonal antibody. In one embodiment, the chimeric antibody contains sufficient human sequences to avoid significant immunogenic reaction when administered to a human In some embodiments, the above-mentioned neurotherapeutic peptide is covalently linked at its amino terminus to the carboxy terminus of the heavy chain of the MAb. In one embodiment, the neurotherapeutic peptide of the above-mentioned composition comprises the amino acid sequence of mature human GDNF.
In a further aspect provided herein is a composition for treating a neurological disorder comprising a neurotherapeutic peptide comprising an amino acid sequence which is at least 80% identical to the amino acid sequence of mature human GDNF covalently linked to an immunoglobulin that is capable of crossing the blood brain barrier, wherein the composition is capable of crossing the BBB in an amount that is effective in treating the neurological disorder. In some embodiments provided herein is a mammalian cell comprising the just-mentioned composition.
In another aspect provided herein is a method of transport of a neurotherapeutic peptide comprising an amino acid sequence which is at least 80% identical to the amino acid sequence of mature human GDNF (SEQ ID NO:52) from the peripheral circulation across the BBB in an effective amount, comprising peripherally administering to an individual the GDNF covalently attached to a structure that crosses the BBB, under conditions where the agent covalently attached to a structure that crosses the BBB is transported across the BBB in an effective amount.
In yet another aspect provided herein is a method for treating a CNS disorder in an individual comprising peripherally administering to the individual an effective amount of a composition comprising a neurotherapeutic peptide comprising an amino acid sequence which is at least 80% (e.g., 95%) identical to the amino acid sequence of human GDNF covalently attached to a structure capable of crossing the BBB. In one embodiment, the neurotherapeutic peptide comprises the amino acid sequence of human GDNF. In some embodiments, the administering is oral, intravenous, intramuscular, subcutaneous, intraperitoneal, rectal, transbuccal, intranasal, transdermal, or inhalation administration. In some embodiments, the CNS disorder is an acute CNS disorder (e.g., spinal cord injury, brain injury focal brain ischemia and global brain ischemia). In other embodiments, the CNS disorder is a chronic CNS disorder (e.g., a chronic neurodegenerative disease, drug addiction, or alcohol addiction). In some embodiments, the chronic neurodegenerative disease is Parkinson's disease or a motor neuron disease (e.g., amyotrophic lateral sclerosis). In some embodiments, the individual to be treated is administered about 1 to about 100 mg of the composition used in above-mentioned method.
In yet another aspect provided herein is a composition comprising a neurotherapeutic peptide comprising an amino acid sequence which is at least 80% identical to the amino acid sequence of human GDNF covalently linked to an immunoglobulin, wherein the neurotherapeutic peptide has a serum half-life that is an average of at least about 5-fold greater than the serum half-life of the neurotherapeutic peptide alone. In some embodiments, the immunoglobulin is an antibody to an endogenous BBB receptor (e.g., the insulin receptor, transferrin receptor, leptin receptor, lipoprotein receptor, or the IGF receptor). In one embodiment, the neurotherapeutic peptide comprises the amino acid sequence of human GDNF.
In a further aspect provided herein is a method for treating substance abuse in an individual, comprising administering to the individual an effective amount of a composition comprising a neurotherapeutic peptide comprising an amino acid sequence which is at least 80% identical to the amino acid sequence of mature human GDNF (SEQ ID NO:52) covalently attached to a structure capable of crossing the BBB.
INCORPORATION BY REFERENCEAll publications and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.
The novel features of the invention are set forth with particularity in the appended claims A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:
I. Introduction
II. Definitions
III. The blood brain barrier
-
- A. Transport systems
- B. Structures that bind to a blood brain barrier receptor-mediated transport system
IV. Agents for transport across the blood brain barrier
-
- A. Neurotrophins
- B. Brain-derived neurotrophic factor
- C. Glial-derived neutrotrophic factor
V. Compositions
VI. Nucleic acids, vectors, cells, and manufacture
-
- A. Nucleic acids
- B. Vectors
- C. Cells
- D. Manufacture
VII. Methods
VIII. Kits
ABBREVIATIONS
-
- AA amino acid
- ALS amyotrophic lateral sclerosis
- AP alkaline phosphatase
- BBB blood-brain barrier
- BCA bicinchoninic acid
- BDNF brain derived neurotrophic factor
- BGH bovine growth hormone
- B max dose causing maximal effect
- BSA bovine serum albumin
- C cysteine
- CDR compementarity determining region
- CED convection enhanced diffusion
- CHO Chinese hamster ovary
- CMV cytomegalovirus
- CNTF ciliary neurotrophic factor
- DC dilutional cloning
- DHFR dihydrofolate reductase
- ECD extracellular domain
- ED50 effective dose causing 50% saturation
- FR framework region
- FS flanking sequence
- FWD forward
- GDNF glial derived neurotrophic factor
- GFR GDNF receptor
- HC heavy chain
- HIR human insulin receptor
- HIRMAb MAb to HIR
- HIRMAb-GDNF fusion protein of HIRMAb and GDNF
- HPLC high pressure liquid chromatography
- HT hypoxanthine-thymidine
- ICV intra-cerebroventricular
- ID injected dose
- IgG immunoglobulin G
- LC light chain
- MAb monoclonal antibody
- MAH mouse anti-human IgG
- MCAO middle cerebral artery occlusion
- MTX methotrexate
- MW molecular weight
- N asparagine
- nt nucleotide
- ODN oligodeoxynucleotide
- pA poly-adenylation
- PAGE polyacrylamide gel electrophoresis
- PBS phosphate buffered saline
- PBST PBS plus Tween-20
- PCR polymerase chain reaction
- PD Parkinson's disease
- pI isoelectric point
- RAG rabbit anti-goat IgG
- REV reverse
- RNase A ribonuclease A
- RT reverse transcriptase
- RT room temperature
- SDM site-directed mutagenesis
- SDS sodium dodecyl sulfate
- SEC size exclusion chromatography
- Ser serine
- SFM serum free medium
- SMA spinal muscular atrophy
- TH tyrosine hydroxylase
- TTC triphenyltetrazolium chloride
- TV tandem vector
- UTV universal TV
- VH variable region of heavy chain
- VL variable region of light chain
I. Introduction
The blood brain barrier is a limiting factor in the delivery of many peripherally-administered agents to the central nervous system. The present invention addresses three factors that are important in delivering an agent across the BBB to the CNS: 1) a pharmacokinetic profile for the agent that allows sufficient time in the peripheral circulation for the agent to have enough contact with the BBB to traverse it; 2) modification of the agent to allow it to cross the BBB; and 3) retention of activity of the agent once across the BBB. Various aspects of the invention address these factors, by providing fusion structures (e.g., fusion proteins) of an agent (e.g., a therapeutic agent) covalently linked to a structure that causes the agent to have increased serum half life, to be transported across the BBB, and/or to retain some or all of its activity in the brain while still attached to the structure.
Accordingly, in one aspect, the invention provides compositions and methods that utilize an agent covalently linked to a structure capable of crossing the blood brain barrier (BBB). The compositions and methods are useful in transporting agents, e.g. therapeutic agents such as neurotherapeutic agents, from the peripheral blood and across the BBB into the CNS. Neurotherapeutic agents useful in the invention include neurotrophins, e.g. brain-derived neurotrophic factor (BDNF) and glial-derived neurotrophic factor (GDNF). In some embodiments, the structure that is capable of crossing the BBB is capable of binding to an endogenous BBB receptor mediated transport system and crossing the BBB. In some embodiments, the structure that is capable of crossing the BBB is an antibody, e.g., a monoclonal antibody (MAb) such as a chimeric MAb.
In some embodiments, the invention provides a fusion protein that includes a structure capable of crossing the BBB covalently linked to a peptide that is active in the central nervous system (CNS), where the structure capable of crossing the blood brain barrier and the peptide that is active in the central nervous system each retain a proportion (e.g., 10-100%) of their activities or their binding affinities for their respective receptors, compared to their activities or their binding affinities for their respective receptors as separate entities.
In another aspect, the invention provides a composition containing a cationic therapeutic peptide covalently linked to an immunoglobulin, where the cationic therapeutic peptide in the composition has a serum and/or circulating half-life that is an average of at least about five fold greater than the serum and/or circulating half-life of the cationic therapeutic peptide alone.
The invention also provides nucleic acids coding for peptides and proteins. In some embodiments, the invention provides a single nucleic acid sequence that contains a gene coding for a light chain of an immunoglobulin and a gene coding for a fusion protein made up of a heavy chain of the immunoglobulin covalently linked to a peptide. In some embodiments the peptide of the fusion protein is a therapeutic peptide, e.g., a neurotherapeutic peptide such as a neurotrophin. The invention also provides vectors containing the nucleic acids of the invention, and cells containing the vectors. Further provided are methods of manufacturing an immunoglobulin fusion protein, where the fusion protein contains an immunoglobulin heavy chain fused to a therapeutic agent, where the methods include integrating into a eukaryotic cell a single tandem expression vector in which both the immunoglobulin light chain gene and the gene for the immunoglobulin heavy chain fused to the therapeutic agent are incorporated into a single piece of DNA.
The invention further provides therapeutic compositions, such as pharmaceutical compositions that contain an agent covalently linked to a structure capable of crossing the blood brain barrier (BBB) and a pharmaceutically acceptable excipient. In some embodiments, the invention provides a composition for treating a neurological disorder that includes a BDNF or a GDNF (e g , human GDNF) covalently linked to an immunoglobulin that is capable of crossing the blood brain barrier, wherein the composition is capable of crossing the BBB in an amount that is effective in treating the neurological disorder.
The invention also provides methods for treating a neurological disorder in an individual that include peripherally administering to the individual an effective amount of one or more of the compositions of the invention, optionally in combination with other therapy for the disorder.
II. Definitions
As used herein, an “agent” includes any substance that is useful in producing an effect, including a physiological or biochemical effect in an organism. A “therapeutic agent” is a substance that produces or is intended to produce a therapeutic effect, i.e., an effect that leads to amelioration, prevention, and/or complete or partial cure of a disorder. A “therapeutic effect,” as that term is used herein, also includes the production of a condition that is better than the average or normal condition in an individual that is not suffering from a disorder, i.e., a supranormal effect such as improved cognition, memory, mood, or other characteristic attributable at least in part to the functioning of the CNS, compared to the normal or average state. A “neurotherapeutic agent” is an agent that produces a therapeutic effect in the CNS. A “therapeutic peptide” includes therapeutic agents that consists of a peptide. A “cationic therapeutic peptide” encompasses therapeutic peptides whose isoelectric point is above about 7.4, in some embodiments, above about 8, 8.5, 9, 9.5, 10, 10.5, 11, 11.5, 12, or above about 12.5. A subcategory of cationic therapeutic peptides is cationic neurotherapeutic peptides.
As used herein, a “peptide that is active in the central nervous system (CNS)” includes peptides that have an effect when administered to the CNS. The effect may be a therapeutic effect or a non-therapeutic effect, e.g., a diagnostic effect or an effect useful in research. If the effect is a therapeutic effect, then the peptide is also a therapeutic peptide. A therapeutic peptide that is also a peptide that is active in the CNS is encompassed by the term “neurotherapeutic peptide,” as used herein.
“Treatment” or “treating” as used herein includes achieving a therapeutic benefit and/or a prophylactic benefit. By therapeutic benefit is meant eradication or amelioration of the underlying disorder or condition being treated. For example, in an individual with a neurological disorder, therapeutic benefit includes partial or complete halting of the progression of the disorder, or partial or complete reversal of the disorder. Also, a therapeutic benefit is achieved with the eradication or amelioration of one or more of the physiological or psychological symptoms associated with the underlying condition such that an improvement is observed in the patient, notwithstanding the fact that the patient may still be affected by the condition. A prophylactic benefit of treatment includes prevention of a condition, retarding the progress of a condition (e.g., slowing the progression of a neurological disorder), or decreasing the likelihood of occurrence of a condition. As used herein, “treating” or “treatment” includes prophylaxis.
As used herein, the term “effective amount” can be an amount sufficient to effect beneficial or desired results, such as beneficial or desired clinical results, or enhanced cognition, memory, mood, or other desired CNS results. An effective amount is also an amount that produces a prophylactic effect, e.g., an amount that delays, reduces, or eliminates the appearance of a pathological or undesired condition. Such conditions of the CNS include dementia, neurodegenerative diseases as described herein, suboptimal memory or cognition, mood disorders, general CNS aging, or other undesirable conditions. An effective amount can be administered in one or more administrations. In terms of treatment, an “effective amount” of a composition of the invention is an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of a disorder, e.g., a neurological disorder. An “effective amount” may be of any of the compositions of the invention used alone or in conjunction with one or more agents used to treat a disease or disorder. An “effective amount” of a therapeutic agent within the meaning of the present invention will be determined by a patient's attending physician or veterinarian. Such amounts are readily ascertained by one of ordinary skill in the art and will a therapeutic effect when administered in accordance with the present invention. Factors which influence what a therapeutically effective amount will be include, the specific activity of the therapeutic agent being used, the type of disorder (e.g., acute vs. chronic neurological disorder), time elapsed since the initiation of the disorder, and the age, physical condition, existence of other disease states, and nutritional status of the individual being treated. Additionally, other medication the patient may be receiving will affect the determination of the therapeutically effective amount of the therapeutic agent to administer
A “subject” or an “individual,” as used herein, is an animal, for example, a mammal In some embodiments a “subject” or an “individual” is a human In some embodiments, the subject suffers from a neurological disorder.
In some embodiments, an agent is “administered peripherally” or “peripherally administered.” As used herein, these terms refer to any form of administration of an agent, e.g., a therapeutic agent, to an individual that is not direct administration to the CNS, i.e., that brings the agent in contact with the non-brain side of the blood-brain barrier. “Peripheral administration,” as used herein, includes intravenous, subcutaneous, intramuscular, intraperitoneal, transdermal, inhalation, transbuccal, intranasal, rectal, and oral administration.
A “pharmaceutically acceptable carrier” or “pharmaceutically acceptable excipient” herein refers to any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition. Such carriers are well known to those of ordinary skill in the art. A thorough discussion of pharmaceutically acceptable carriers/excipients can be found in Remington's Pharmaceutical Sciences, Gennaro, A R, ed., 20th edition, 2000: Williams and Wilkins PA, USA. Exemplary pharmaceutically acceptable carriers can include salts, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like. For example, compositions of the invention may be provided in liquid form, and formulated in saline based aqueous solution of varying pH (5-8), with or without detergents such polysorbate-80 at 0.01-1%, or carbohydrate additives, such mannitol, sorbitol, or trehalose. Commonly used buffers include histidine, acetate, phosphate, or citrate.
A “recombinant host cell” or “host cell” refers to a cell that includes an exogenous polynucleotide, regardless of the method used for insertion, for example, direct uptake, transduction, f-mating, or other methods known in the art to create recombinant host cells. The exogenous polynucleotide may be maintained as a nonintegrated vector, for example, a plasmid, or alternatively, may be integrated into the host genome.
The terms “polypeptide,” “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. That is, a description directed to a polypeptide applies equally to a description of a peptide and a description of a protein, and vice versa. The terms apply to naturally occurring amino acid polymers as well as amino acid polymers in which one or more amino acid residues is a non-naturally occurring amino acid, e.g., an amino acid analog. As used herein, the terms encompass amino acid chains of any length, including full length proteins (i.e., antigens), wherein the amino acid residues are linked by covalent peptide bonds.
The term “amino acid” refers to naturally occurring and non-naturally occurring amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally encoded amino acids are the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrolysine and selenocysteine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (such as, norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
The term “nucleic acid” refers to deoxyribonucleotides, deoxyribonucleosides, ribonucleosides, or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides which have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless specifically limited otherwise, the term also refers to oligonucleotide analogs including PNA (peptidonucleic acid), analogs of DNA used in antisense technology (phosphorothioates, phosphoroamidates, and the like). Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof, including, but not limited to, degenerate codon substitutions, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Cassol et al. (1992); Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
The terms “isolated” and “purified” refer to a material that is substantially or essentially removed from or concentrated in its natural environment. For example, an isolated nucleic acid may be one that is separated from the nucleic acids that normally flank it or other nucleic acids or components (proteins, lipids, etc. . . . ) in a sample. In another example, a polypeptide is purified if it is substantially removed from or concentrated in its natural environment. Methods for purification and isolation of nucleic acids and peptides are well known in the art.
III. The Blood Brain Barrier
In one aspect, the invention provides compositions and methods that utilize an agent covalently linked to a structure capable of crossing the blood brain barrier (BBB). The compositions and methods are useful in transporting agents, e.g. therapeutic agents such as neurotherapeutic agents, from the peripheral blood and across the BBB into the CNS. As used herein, the “blood-brain barrier” refers to the barrier between the peripheral circulation and the brain and spinal cord which is formed by tight junctions within the brain capillary endothelial plasma membranes, creates an extremely tight barrier that restricts the transport of molecules into the brain, even molecules as small as urea, molecular weight of 60 Da. The blood-brain barrier within the brain, the blood-spinal cord barrier within the spinal cord, and the blood-retinal barrier within the retina, are contiguous capillary barriers within the central nervous system (CNS), and are collectively referred to as the blood-brain barrier or BBB.
The BBB is a limiting step in the development of new neurotherapeutics, diagnostics, and research tools for the brain and CNS. In general, large molecule therapeutics such as recombinant proteins, antisense drugs, gene medicines, monoclonal antibodies, or RNA interference (RNAi)-based drugs, do not cross the BBB in pharmacologically significant amounts. While it is generally assumed that small molecule drugs can cross the BBB, in fact, <2% of all small molecule drugs are active in the brain owing to the lack transport across the BBB. A molecule must be lipid soluble and have a molecular weight less than 400 Daltons (Da) in order to cross the BBB in pharmacologically significant amounts, and the vast majority of small molecules do not have these dual molecular characteristics. Therefore, most potentially therapeutic, diagnostic, or research molecules do not cross the BBB in pharmacologically active amounts. So as to bypass the BBB, invasive transcranial drug delivery strategies are used, such as intracerebro-ventricular (ICV) infusion, intracerebral (IC) administration, and convection enhanced diffusion (CED). Transcranial drug delivery to the brain is expensive, invasive, and largely ineffective. The ICV route delivers BDNF only to the ependymal surface of the brain, not into brain parenchyma, which is typical for drugs given by the ICV route. The IC administration of a neurotrophin, such as nerve growth factor (NGF), only delivers drug to the local injection site, owing to the low efficiency of drug diffusion within the brain. The CED of neurotrophin results in preferential fluid flow through the white matter tracts of brain, which causes demyelination, and astrogliosis.
The present invention offers an alternative to these highly invasive and generally unsatisfactory methods for bypassing the BBB, allowing agents, e.g., neuroprotective factors to cross the BBB from the peripheral blood. It is based on the use of endogenous transport systems present in the BBB to provide a mechanism to transport a desired substance from the peripheral blood to the CNS.
A. Transport Systems
In some embodiments, the invention provides compositions that include a structure that binds to a BBB receptor mediated transport system, coupled to an agent for which transport across the BBB is desired, e.g., a neurotherapeutic agent. The compositions and methods of the invention may utilize any suitable structure that is capable of transport by the selected endogenous BBB receptor-mediated transport system, and that is also capable of attachment to the desired agent. In some embodiments, the structure is an antibody. In some embodiment the antibody is a monoclonal antibody (MAb), e.g., a chimeric MAb.
Endogenous BBB receptor-mediated transport systems The BBB has been shown to have specific receptors that allow the transport from the blood to the brain of several macromolecules; these transporters are suitable as transporters for compositions of the invention. Endogenous BBB receptor-mediated transport systems useful in the invention include those that transport insulin, transferrin, insulin-like growth factors 1 and 2 (IGF1 and IGF2), leptin, and lipoproteins. In some embodiments, the invention utilizes a structure that is capable of crossing the BBB via the endogenous insulin BBB receptor-mediated transport system, e.g., the human endogenous insulin BBB receptor-mediated transport system.
B. Structures that Bind to a BBB Receptor Mediated Transport System
One noninvasive approach for the delivery of drugs to the CNS is to attach the agent of interest to a structure, e.g., molecule that binds with receptors on the BBB. The structure then serves as a vector for transport of the agent across the BBB. Such structures are referred to herein as “molecular Trojan horses (MTH).” Typically, though not necessarily, a MTH is an exogenous peptide or peptidomimetic moiety (e.g., a MAb) capable of binding to an endogenous BBB receptor mediated transport system that traverses the BBB on the endogenous BBB receptor-mediated transport system. In certain embodiments, the MTH can be an antibody to a receptor of the transport system, e.g., the insulin receptor. In some embodiments, the antibody is a monoclonal antibody (MAb). In some embodiments, the MAb is a chimeric MAb. Thus, despite the fact that Abs normally are excluded from the brain, they can be an effective vehicle for the delivery of molecules into the brain parenchyma if they have specificity for receptors on the BBB.
Accordingly, antibodies are particularly useful in embodiments of the invention, especially MAbs. Certain receptor-specific MAbs may mimic the endogenous ligand and function as a MTH and traverse a plasma membrane barrier via transport on the specific receptor system. In certain embodiments, the MTH is a MAb to the human insulin receptor (HIR) on the human BBB. The HIR MAb binds an exofacial epitope on the human BBB HIR and this binding enables the MAb to traverse the BBB via a transport reaction that is mediated by the human BBB insulin receptor.
An “antibody,” as that term is used herein, includes reference to any molecule, whether naturally-occurring, artificially induced, or recombinant, which has specific immunoreactive activity. Generally, though not necessarily, an antibody is a protein that includes two molecules, each molecule having two different polypeptides, the shorter of which functions as the light chains of the antibody and the longer of which polypeptides function as the heavy chains of the antibody. Normally, as used herein, an antibody will include at least one variable region from a heavy or light chain. Additionally, the antibody may comprise combinations of variable regions. The combination may include more than one variable region of a light chain or of a heavy chain The antibody may also include variable regions from one or more light chains in combination with variable regions of one or more heavy chains An antibody can be an immunoglobulin molecule obtained by in vitro or in vivo generation of the humoral response, and includes both polyclonal and monoclonal antibodies. Furthermore, the present invention includes antigen binding fragments of the antibodies described herein, such as Fab, Fab′, F(ab)2, and Fv fragments, fragments comprised of one or more CDRs, single-chain antibodies (e.g., single chain Fv fragments (scFv)), disulfide stabilized (dsFv) Fv fragments, heteroconjugate antibodies (e.g., bispecific antibodies), pFv fragments, heavy chain monomers or dimers, light chain monomers or dimers, and dimers consisting of one heavy chain and one light chain Such antibody fragments may be produced by chemical methods, e.g., by cleaving an intact antibody with a protease, such as pepsin or papain, or via recombinant DNA techniques, e.g., by using host cells transformed with truncated heavy and/or light chain genes. Synthetic methods of generating such fragments are also contemplated. Heavy and light chain monomers may similarly be produced by treating an intact antibody with a reducing agent, such as dithiothreitol or beta-mercaptoethanol, or by using host cells transformed with DNA encoding either the desired heavy chain or light chain or both. An antibody immunologically reactive with a particular antigen can be generated in vivo or by recombinant methods such as selection of libraries of recombinant antibodies in phage or similar vectors.
A “chimeric” antibody includes an antibody derived from a combination of different mammals The mammal may be, for example, a rabbit, a mouse, a rat, a goat, or a human. The combination of different mammals includes combinations of fragments from human and mouse sources.
In some embodiments, an antibody of the present invention is a monoclonal antibody (MAb), typically a human monoclonal antibody. Such antibodies are obtained from transgenic mice that have been “engineered” to produce specific human antibodies in response to antigenic challenge. In this technique, elements of the human heavy and light chain locus are introduced into strains of mice derived from embryonic stem cell lines that contain targeted disruptions of the endogenous heavy chain and light chain loci. The transgenic mice can synthesize human antibodies specific for human antigens, and the mice can be used to produce human antibody-secreting hybridomas.
For use in humans, a chimeric MAb is preferred that contains enough human sequence that it is not significantly immunogenic when administered to humans, e g , at least about 80% human and about 20% mouse, or about 85% human and about 15% mouse, or about 90% human and about 10% mouse, or about 95% human and 5% mouse, or greater than about 95% human and less than about 5% mouse. Chimeric antibodies to the human BBB insulin receptor with sufficient human sequences for use in the invention are described in, e.g., Coloma et al. (2000) Pharm. Res. 17: 266-274, which is incorporated by reference herein in its entirety. A more highly humanized form of the HIR MAb can also be engineered, and the humanized HIRMAb has activity comparable to the murine HIRMAb and can be used in embodiments of the invention. See, e.g., U.S. Patent Application Publication No. 20040101904, filed Nov. 27, 2002, incorporated by reference herein in its entirety.
Antibodies used in the invention may be glycosylated or non-glycosylated. If the antibody is glycosylated, any pattern of glycosylation that does not significantly affect the function of the antibody may be used. Glycosylation can occur in the pattern typical of the cell in which the antibody is made, and may vary from cell type to cell type. For example, the glycosylation pattern of a monoclonal antibody produced by a mouse myeloma cell can be different than the glycosylation pattern of a monoclonal antibody produced by a transfected Chinese hamster ovary (CHO) cell. In some embodiments, the antibody is glycosylated in the pattern produced by a transfected Chinese hamster ovary (CHO) cell.
Accordingly, in some embodiments, a genetically engineered HIR MAb, with the desired level of human sequences, is fused to an agent for which transport across the BBB is desired, e.g., a neurotherapeutic agent such as a neurotrophin such as human BDNF, to produce a recombinant fusion protein that is a bi-functional molecule. The recombinant therapeutic neuroprotective factor/HIRMAb is able to both (i) cross the human BBB, via transport on the BBB HIR, and (ii) activate the factor's target, e.g., neuronal BDNF receptor, trkB, to cause neurotherapeutic effects once inside the brain, following peripheral administration.
IV. Agents for Transport Across the BBB
The agent for which transport across the BBB is desired may be any suitable substance for introduction into the CNS. Generally, the agent is a substance for which transport across the BBB is desired, which does not, in its native form, cross the BBB in significant amounts. The agent may be, e.g., a therapeutic agent, a diagnostic agent, or a research agent. Diagnostic agents include peptide radiopharmaceuticals, such as radiolabeled epidermal growth factor (EGF) for imaging brain cancer (Kurihara and Pardridge (1999) Canc. Res. 54: 6159-6163), and amyloid peptides for imaging brain amyloid such as in Alzheimers disease (Lee et al (2002) J. Cereb. Blood Flow Metabol. 22: 223-231). In some embodiments, the agent is a therapeutic agent, such as a neurotherapeutic agent. Apart from neurotrophins, potentially useful therapeutic protein agents include recombinant enzymes for lysosomal storage disorders (see, e.g., U.S. Patent Application Publication No. 20050142141, filed Feb. 17, 2005, incorporated by reference herein in its entirety), monoclonal antibodies that either mimic an endogenous peptide or block the action of an endogenous peptide, polypeptides for brain disorders, such as secretin for autism (Ratliff-Schaub et al (2005) Autism 9: 256-265), opioid peptides for drug or alchol addiction (Cowen et al, (2004) J. Neurochem. 89: 273-285), or neuropeptides for appetite control (Jethwa et al (2005) Am. J. Physiol. 289: E301-305). In some embodiments, the agent is a neurotrophic factor, also referred to herein as a “neurotrophin.” Thus, in some embodiments, the invention provides compositions and methods that utilize a neurotrophin. In some embodiments, a single neurotrophin may be used. In others, combinations of neurotrophins are used. In some embodiments, the invention utilizes a brain-derived neurotrophic factor (BDNF). In other embodiments, the invention utilizes a glial-derived neurotrophic factor.
A. Neurotrophins
Many neurotrophic factors are neuroprotective in brain, but do not cross the blood-brain barrier. These factors are suitable for use in the compositions and methods of the invention and include brain-derived neurotrophic factor (BDNF), nerve growth factor (NGF), neurotrophin-4/5, fibroblast growth factor (FGF)-2 and other FGFs, neurotrophin (NT)-3, erythropoietin (EPO), hepatocyte growth factor (HGF), epidermal growth factor (EGF), transforming growth factor (TGF)-α, TGF-β, vascular endothelial growth factor (VEGF), interleukin-1 receptor antagonist (IL-1ra), ciliary neurotrophic factor (CNTF), glial-derived neurotrophic factor (GDNF), neurturin, platelet-derived growth factor (PDGF), heregulin, neuregulin, artemin, persephin, interleukins, granulocyte-colony stimulating factor (CSF), granulocyte-macrophage-CSF, netrins, cardiotrophin-1, hedgehogs, leukemia inhibitory factor (LIF), midkine, pleiotrophin, bone morphogenetic proteins (BMPs), netrins, saposins, semaphorins, and stem cell factor (SCF). Particularly useful in some embodiments of the invention utilizing neurotrophins that are used as precursors for fusion proteins that cross the BBB are those that naturally form dimeric structures, similar to BDNF. Certain neurotrophins such as BDNF or NT-3 may form hetero-dimeric structures, and in some embodiments the invention provides a fusion protein constructed of one neurotrophin monomer fused to one chain (e.g., a light or heavy chain) of an antibody, e.g., of the HIRMAb, and another neurotrophin monomer fused to the second chain (e.g., a light or heavy chain) of the antibody. Typically, the molecular weight range of recombinant proteins that may be fused to the molecular Trojan horse ranges from 1000 Daltons to 500,000 Daltons.
B. Brain-Derived Neurotrophic Factor
One particularly useful neurotrophin in embodiments of the invention is brain-derived neurotrophic factor (BDNF). In experimental models of chronic neurodegenerative disease such as prion diseases, Alzheimer's disease (AD), Parkinson's disease (PD), Huntington's disease (HD), or amyotrophic lateral sclerosis (ALS), the direct intracerebral injection of BDNF is neuroprotective.
In studies demonstrating the pharmacologic efficacy of BDNF in experimental brain disease, it is necessary to administer the neurotrophin directly into the brain following a transcranial drug delivery procedure. The transcranial drug delivery is required because BDNF does not cross the brain capillary wall, which forms the blood-brain barrier (BBB) in vivo. Owing to the lack of transport of BDNF across the BBB, it is not possible for the neurotrophin to enter the CNS, including the brain or spinal cord, following a peripheral administration unless the BBB is experimentally disrupted. Clinical trials showed that subcutaneous administration of BDNF was not effective in the treatment of chronic neurodegenerative conditions, which derives from the lack of transport of BDNF across the BBB. The lack of utility of BDNF as a CNS therapeutic following peripheral administration is expected and follows from the limiting role that is played by the BBB in the development of neurotherapeutics, especially large molecule drugs such as BDNF. BDNF does not cross the BBB, and the lack of transport of the neurotrophin across the BBB prevents the molecule from being pharmacologically active in the brain following peripheral administration. The lack of BDNF transport across the BBB means that the neurotrophin must be directly injected into the brain across the skull bone to be pharmacologically active in the CNS. However, when the BDNF is fused to a Trojan horse such as the HIR MAb, this neurotrophin is now able to enter brain from blood following a non-invasive peripheral route of administration such as intravenous intramuscular, subcutaneous, intraperitoneal, or even oral administration. Owing to the BBB transport properties of this new class of molecule, it is not necessary to administer the BDNF directly into the CNS with an invasive delivery procedure requiring penetration of the skull or spinal canal. The reformulated fusion protein of the BDNF variant and the HIR MAb now enables entry of BDNF into the brain from the blood, and the development of BDNF as a neurotherapeutic for human diseases.
The forms of BDNF used in various embodiments of the invention may include pharmaceutically acceptable salts and prodrugs, and prodrugs of the salts, polymorphs, hydrates, solvates, biologically-active fragments, biologically active variants and stereoisomers of the naturally-occurring BDNF, as well as agonist, mimetic, and antagonist variants of the naturally-occurring BDNF and polypeptide fusions thereof. Variants that include one or more deletions, substitutions, or insertions in the natural sequence of the BDNF, in particular truncated versions of the native BDNF comprising deletion of one or more amino acids at the amino terminus, carboxyl terminus, or both, may also be used in certain embodiments.
In some embodiments, the invention utilizes a carboxy-truncated variant of the native BDNF, e.g., a variant in which 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more than 10 amino acids are absent from the carboxy-terminus of the BDNF. BDNF variants include the complete 119 amino acid BDNF, the 117 or 118 amino acid variant with a truncated carboxyl terminus, variants with a truncated amino terminus, or variants with up to about a 20, 30, or 40% change in amino acid composition, as long as the fusion protein variant still binds to the brain neuroprotection receptor with high affinity. When an Ab, e.g., a MAb such as HIRMAb is used, additional fusion protein variants can be produced with the substitution of amino acids within either the framework region (FR) or the complementarity determining region (CDR) of either the light chain or the heavy chain of the Ab, e.g., HIRMAb, as long as the fusion protein binds with high affinity to the endogenous receptor, e.g., HIR to promote transport across the human BBB. Additional fusion protein variants can be produced by changing the composition or length of the linker peptide separating the fusion protein from the HIRMAb.
In some embodiments, the full-length 119 a.a. sequence of BDNF is utilized (SEQ ID NO: 39). In some embodiments, a one amino-acid carboxy-truncated variant of BDNF is utilized (amino acids 1-118 of SEQ ID NO: 39). In some embodiments, a two amino-acid carboxy-truncated variant of BDNF is utilized (amino acids 1-117 of SEQ ID NO: 39). In some embodiments, a three amino-acid carboxy-truncated variant of BDNF is utilized (amino acids 1-116 of SEQ ID NO: 39). In some embodiments, a four amino-acid carboxy-truncated variant of BDNF is utilized (amino acids 1-115 of SEQ ID NO: 39). In some embodiments, a five amino-acid carboxy-truncated variant of BDNF is utilized (amino acids 1-114 of SEQ ID NO: 39).
The sequence of human BDNF is given in SEQ ID NO: 39. In some embodiments, the invention utilizes a BDNF that is about 60, 70, 80, 90, 95, 99, or 100% identical with the sequence of SEQ ID NO: 39, or a truncated version thereof, e.g., the 117 or 118 amino acid variant with a one- or two-amino acid truncated carboxyl terminus, or variants with a truncated amino terminus. In some embodiments, the invention utilizes a two amino-acid carboxy-truncated 117 amino acid variant human BDNF with a sequence that is at least about 60, 70, 80, 90, 95, 99 or 100% identical to the sequence of amino acids 466-582 of SEQ ID NO: 24. In some embodiments, the invention utilizes a two amino-acid carboxy-truncated human 117 amino acid BDNF with a sequence that includes amino acids 466-582 of SEQ ID NO: 24.
Accordingly, BDNFs useful in the invention include peptides having at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or greater than 95% or greater than 99% sequence identity, e.g., 100% sequence identity, to the amino acid sequences disclosed herein.
C. Glial-Derived Neurotrophic Factor.
Another particularly useful neurotrophin in embodiments of the invention is glial-derived neurotrophic factor (GDNF). GDNF is a neurotrophic factor that can be used in the treatment of many acute and chronic brain diseases. However, the lack of transport of GDNF across the BBB has prevented the development of this molecule as a neurotherapeutic for the brain and spinal cord.
Acute brain conditions that can be treated by the GDNF-containing compositions described herein include, but are not limited to, spinal cord injury, brain injury (e.g., traumatic brain injury), focal brain ischemia, and global brain ischemia.
Chronic brain conditions that can be treated by the GDNF-containing compositions described herein include, but are not limited to neurodegenerative disease such as Parkinson's disease, motor neuron disease (e.g., spinal cord motor neuron disease such as amyotrophic lateral sclerosis); and substance abuse, e.g., addiction, including drug addiction and alchohol addiction.
The forms of GDNF used in various embodiments of the invention may include acceptable salts and prodrugs, and prodrugs of the salts, polymorphs, hydrates, solvates, biologically-active fragments, biologically active variants and stereoisomers of the naturally-occurring GDNF (e g , human GDNF and mature human GDNF), as well as agonist, mimetic, and antagonist variants of the naturally-occurring GDNF and polypeptide fusions thereof. Variants that include one or more deletions, substitutions, or insertions in the natural sequence of the GDNF may also be used in certain embodiments. insofar as the variants retain binding and/or activation of GFRα1. The structure-function relationship of GDNF and its ability to bind and activate GFRα1 has been studied extensively. See, e.g., Eketjäl et al (1999), EMBO J, 18(21):5901-5910; and Baloh et al (2000), J Biol Chem, 275(5):3412-3420. For example mutations known to be particularly sensitive to mutation include, e.g., the following residues in rat GDNF: D52, E61, E62, D116, I64, L114, L118, Y120, I122, and C101. Functional assays for GDNF are known in the art. See, e.g., Eketjäl et al, or Baloh et al supra. Functional assays for GDNF are also described in Example 15 herein.
When an Ab, e.g., a MAb such as HIRMAb is used, additional fusion protein variants can be produced with the substitution of amino acids within either the framework region (FR) or the complementarity determining region (CDR) of either the light chain or the heavy chain of the Ab, e.g., HIRMAb, as long as the fusion protein binds with high affinity to the endogenous receptor, e.g., HIR to promote transport across the human BBB. Additional fusion protein variants can be produced by changing the composition or length of the linker peptide separating the fusion protein from the HIRMAb.
In some embodiments, the full-length 211 a.a. sequence of human prepro GDNF is utilized (GenBank P39905). The sequence of human preproGDNF is given in SEQ ID NO: 44. In other embodiments, the mature form of human GDNF comprising amino acids Ser-78 to Ile 211 (SEQ ID NO: 52) is utilized: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEEL IFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCG CI (SEQ ID NO:52).
In some embodiments, the invention utilizes a GDNF that is about 60, 70, 80, 90, 95, 99, or 100% identical with the sequence of SEQ ID NO:52.
Accordingly, GDNFs useful in the invention include peptides having at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or greater than 95% or greater than 99% sequence identity, e.g., 100% sequence identity, to the amino acid sequences disclosed herein
Percent sequence identity is determined by conventional methods. See, for example, Altschul et al., Bull. Math. Bio. 48:603 (1986), and Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1992). Briefly, two amino acid sequences are aligned to optimize the alignment scores using a gap opening penalty of 10, a gap extension penalty of 1, and the “BLOSUM62” scoring matrix of Henikoff and Henikoff (ibid.). The percent identity is then calculated as: ([Total number of identical matches]/[length of the longer sequence plus the number of gaps introduced into the longer sequence in order to align the two sequences])(100).
Those skilled in the art appreciate that there are many established algorithms available to align two amino acid sequences. The “FASTA” similarity search algorithm of Pearson and Lipman is a suitable protein alignment method for examining the level of identity shared by an amino acid sequence disclosed herein and the amino acid sequence of another peptide. The FASTA algorithm is described by Pearson and Lipman, Proc. Nat'l Acad. Sci. USA 85:2444 (1988), and by Pearson, Meth. Enzymol. 183:63 (1990). Briefly, FASTA first characterizes sequence similarity by identifying regions shared by the query sequence (e.g., SEQ ID NO:44 or SEQ ID NO:52) and a test sequence that have either the highest density of identities (if the ktup variable is 1) or pairs of identities (if ktup=2), without considering conservative amino acid substitutions, insertions, or deletions. The ten regions with the highest density of identities are then rescored by comparing the similarity of all paired amino acids using an amino acid substitution matrix, and the ends of the regions are “trimmed” to include only those residues that contribute to the highest score. If there are several regions with scores greater than the “cutoff” value (calculated by a predetermined formula based upon the length of the sequence and the ktup value), then the trimmed initial regions are examined to determine whether the regions can be joined to form an approximate alignment with gaps. Finally, the highest scoring regions of the two amino acid sequences are aligned using a modification of the Needleman-Wunsch-Sellers algorithm (Needleman and Wunsch, J. Mol. Biol. 48:444 (1970); Sellers, SIAM J. Appl. Math. 26:787 (1974)), which allows for amino acid insertions and deletions. Illustrative parameters for FASTA analysis are: ktup=1, gap opening penalty=10, gap extension penalty=1, and substitution matrix=BLOSUM62. These parameters can be introduced into a FASTA program by modifying the scoring matrix file (“SMATRIX”), as explained in Appendix 2 of Pearson, Meth. Enzymol. 183:63 (1990).
The present invention also includes peptides having a conservative amino acid change, compared with an amino acid sequence disclosed herein. Many such changes have been described specifically. More generally, for example, variants can be obtained that contain one or more amino acid substitutions of SEQ ID NO:52. In some embodiments sequence variants include conservative amino acid substitutions, e.g., an alkyl amino acid is substituted for an alkyl amino acid in a GDNF peptide amino acid sequence, an aromatic amino acid is substituted for an aromatic amino acid in a GDNF peptide amino acid sequence, a sulfur-containing amino acid is substituted for a sulfur-containing amino acid in a GDNF peptide amino acid sequence, a hydroxy-containing amino acid is substituted for a hydroxy-containing amino acid in a GDNF peptide amino acid sequence, an acidic amino acid is substituted for an acidic amino acid in a GDNF peptide amino acid sequence, a basic amino acid is substituted for a basic amino acid in GDNF peptide amino acid sequence, or a dibasic monocarboxylic amino acid is substituted for a dibasic monocarboxylic amino acid in a GDNF peptide amino acid sequence. Among the common amino acids, for example, a “conservative amino acid substitution” is illustrated by a substitution among amino acids within each of the following groups: (1) glycine, alanine, valine, leucine, and isoleucine, (2) phenylalanine, tyrosine, and tryptophan, (3) serine and threonine, (4) aspartate and glutamate, (5) glutamine and asparagine, and (6) lysine, arginine and histidine. The BLOSUM62 table is an amino acid substitution matrix derived from about 2,000 local multiple alignments of protein sequence segments, representing highly conserved regions of more than 500 groups of related proteins (Henikoff and Henikoff, Proc. Nat'l Acad. Sci. USA 89:10915 (1992)). Accordingly, the BLOSUM62 substitution frequencies can be used to define conservative amino acid substitutions that may be introduced into the amino acid sequences of the present invention. Although it is possible to design amino acid substitutions based solely upon chemical properties (as discussed above), the language “conservative amino acid substitution” preferably refers to a substitution represented by a BLOSUM62 value of greater than −1. For example, an amino acid substitution is conservative if the substitution is characterized by a BLOSUM62 value of 0, 1, 2, or 3. According to this system, preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 1 (e.g., 1, 2 or 3), while more preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 2 (e.g., 2 or 3).
It also will be understood that amino acid sequences may include additional residues, such as additional N- or C-terminal amino acids, and yet still be essentially as set forth in one of the sequences disclosed herein, so long as the sequence retains sufficient biological protein activity to be functional in the compositions and methods of the invention.
In some embodiments, where GDNF sequence variants (e.g., variants of SEQ ID NO:52) are to be utilized, mutation tolerance prediction programs can be used to greatly reduce the number of non-functional sequence variants that would be generated by strictly random mutagenesis. Various programs for predicting the effects of amino acid substitutions in a protein sequence on protein function (e.g., SIFT, PolyPhen, PANTHER PSEC, PMUT, and TopoSNP) are described in, e.g., Henikoff et al., (2006), Annu. Rev. Genomics Hum. Genet., 7:61-80.
D. Alpha-L-Iduronidase
Alpha-L-iduronidase (IDUA) is the enzyme missing in patients with Hurler syndrome or type I mucopolysaccharidosis (MPS), which adversely affects the brain. The brain pathology ultimately results in early death for children carrying this genetic disease. IDUA enzyme replacement therapy (ERT) for patients with MPS type I is not effective for the brain disease, because the enzyme does not cross the BBB. This is a serious problem and means the children with this disease will die early even though they are on ERT. The enzyme could be delivered across the human BBB following peripheral administration providing the enzyme is attached to a molecular Trojan horse such as the humanized HIRMAb. The IDUA may be attached to the humanized HIRMAb with avidin-biotin technology. In this approach, the IDUA enzyme is mono-biotinylated in parallel with the production of a fusion protein of the humanized HIRMAb and avidin. In addition, the IDUA could be attached to the humanized HIRMAb not with avidin-biotin technology, but with genetic engineering that avoids the need for biotinylation or the use of foreign proteins such as avidin. In this approach, the gene encoding for IDUA is fused to the region of the humanized HIRMAb heavy chain or light chain gene corresponding to the amino or carboxyl terminus of the HIRMAb heavy or light chain protein.
V. Compositions
Compositions of the invention are useful in one or more of: increasing serum half-life of a cationic compound, transporting an agent across the BBB, and/or retaining activity of the agent once transported across the BBB. Accordingly, in some embodiments, the invention provides compositions containing a neurotherapeutic agent covalently linked to a structure that is capable of crossing the blood brain barrier (BBB), where the composition is capable of producing an average elevation of concentration in the brain of the neurotherapeutic agent of at least about 1, 2, 3, 4, 5, 10, 20, 30, 40, or 50 ng/gram brain following peripheral administration. The invention also provides compositions containing an agent that is covalently linked to a chimeric MAb to the human BBB insulin receptor. The invention further provides a fusion protein containing a structure capable of crossing the BBB, covalently linked to a peptide that is active in the central nervous system (CNS), where the structure capable of crossing the blood brain barrier and the peptide that is active in the central nervous system each retain an average of at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 95, 99, or 100% of their activities, compared to their activities as separate entities. In certain embodiments, the invention further provides compositions that increase the serum half-life of cationic substances. The invention also provides pharmaceutical compositions that contain one or more compositions of the invention and a pharmaceutically acceptable excipient.
In some embodiments, the invention provides compositions containing a neurotherapeutic agent covalently linked to a structure that is capable of crossing the blood brain barrier (BBB), where the composition is capable of producing an average elevation of concentration in the brain of the neurotherapeutic agent of at least about 1, 2, 3, 4, 5, 10, 20, 30, 40, or 50 ng/gram brain following peripheral administration.
“Elevation” of the agent is an increase in the brain concentration of the agent compared to the concentration of the agent administered alone (i.e., not covalently linked to a structure that is capable of crossing the BBB). In the case of agents for which only a small amount of the agent alone normally crosses the BBB, “elevation” may be an increase in the agent compared to resting brain levels. “Average” refers to the mean of at least three, four, five, or more than five measurements, preferably in different individuals. The individual in which the elevation is measured is a mammal, such as a rat, or, preferably, a primate, e.g., a monkey. An example of measurements of elevation of the level of a neurotherapeutic agent (BDNF) is given in Example 7.
In some embodiments, the structure that is capable of crossing the BBB utilizes an endogenous BBB receptor mediated transport system, such as a system that utilizes the insulin receptor, transferrin receptor, leptin receptor, LDL receptor, or IGF receptor. In some embodiments, the endogenous BBB receptor mediated transport system is the insulin BBB receptor mediated transport system. In some embodiments, the structure that is capable of crossing the BBB is an antibody, e.g., a monoclonal antibody (MAb) such as a chimeric MAb. The antibody can be a chimeric antibody with sufficient human sequence that it is suitable for administration to a human. The antibody can be glycosylated or nonglycosylated; in some embodiments, the antibody is glycosylated, e.g., in a glycosylation pattern produced by its synthesis in a CHO cell. In embodiments in which the structure is an antibody, the covalent linkage between the antibody and the neurotherapeutic agent may be a linkage between any suitable portion of the antibody and the neurothempeutic agent, as long as it allows the antibody-agent fusion to cross the blood brain barrier and the neurotherapeutic agent to retain a therapeutically useful portion of its activity within the CNS. In certain embodiments, the covalent link is between one or more light chains of the antibody and the neurotherapeutic agent. In the case of a peptide neurotherapeutic agent (e.g., a neurotrophin such as GDNF), the peptide can be covalently linked by its carboxy or amino terminus to the carboxy or amino terminus of the light chain (LC) or heavy chain (HC) of the antibody. Any suitable linkage may be used, e.g., carboxy terminus of light chain to amino terminus of peptide, carboxy terminus of heavy chain to amino terminus of peptide, amino terminus of light chain to amino terminus of peptide, amino terminus of heavy chain to amino terminus of peptide, carboxy terminus of light chain to carboxy terminus of peptide, carboxy terminus of heavy chain to carboxy terminus of peptide, amino terminus of light chain to carboxy terminus of peptide, or amino terminus of heavy chain to carboxy terminus of peptide. In some embodiments, the linkage is from the carboxy terminus of the HC to the amino terminus of the peptide. It will be appreciated that a linkage between terminal amino acids is not required, and any linkage which meets the requirements of the invention may be used; such linkages between non-terminal amino acids of peptides are readily accomplished by those of skill in the art.
In some embodiments, the invention utilizes BDNF, either the native form or truncated variants. Strikingly, it has been found that fusion proteins of these forms of BDNF retain full transport and activity. This is surprising because the neurotrophin is translated in vivo in cells as a prepro form and the prepro-BDNF is then converted into mature BDNF following cleavage of the prepro peptide from the amino terminus of the BDNF. In order to preserve the prepro form of the BDNF, and the subsequent cleavability of the prepro peptide, it would seem to be necessary to fuse the prepro BDNF to the amino terminus of either the HC or the LC of the targeting MAb. This could, however, inhibit the binding of the MAb for the target antigen, since the complementarity determining regions (CDR) of the heavy chain or light chain of the MAb molecule, which comprise the antigen binding site of the MAb, are situated near the amino terminus of the heavy chain or light chains of the antibody. Therefore, fusion of the prepro-neurotrophin to the amino terminus of the antibody chains is expected to result in not only impairment of antibody activity, but also an impairment of antibody folding following translation. The present invention shows the unexpected finding that it is possible to fuse the mature form of a neurotrophin, such as a BDNF variant (vBDNF), to the carboxyl terminus of the heavy chain of the HIR MAb. The production of this new genetically engineered fusion protein creates a bi-functional molecule that binds with high affinity to both the HIR and the trkB receptors.
In other embodiments, the invention utilizes GDNF (e.g., mature human GDNF) or a sequence variant of GDNF as described herein.
In some embodiments, more than one molecule of the same neurotherapeutic agent is attached to the structure that crosses the BBB. For example, in compositions of the invention where a single neurotrophin is attached to an antibody, one molecule of the neurotrophin is attached to each heavy chain, naturally producing a structure that is ideal for homodimer formation. This is the case for compositions containing BDNF or GDNF. Neurotrophins such as BDNF or GDNF require an obligatory formation of a homo-dimeric structure to be biologically active, and to bind with high affinity to the cognate receptor, e.g. TrkB or GFRα1. A naturally occurring homo-dimeric structure between two BDNF molecules is formed when the neurotrophin is fused to a carboxyl terminus of the CH3 region of an IgG molecule, as illustrated in
In some embodiments, more than one type of neurotherapeutic agent can be attached to the structure that is capable of crossing the blood brain barrier. In some embodiments, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more than 10 different neurotherapeutic agents may be attached to the structure that is capable of crossing the blood brain barrier. In certain embodiments, 2 different neurotrophins are attached to an antibody to an endogenous BBB receptor-mediated transport system. Any combination of neurotrophins may be used. Particularly useful in some embodiments of the invention are neurotrophins used as precursors for fusion proteins that cross the BBB are those that naturally form dimeric structures, similar to BDNF or GDNF. Certain neurotrophins such as BDNF or NT-3 may form hetero-dimeric structures, and in some embodiments the invention provides a fusion protein constructed of one neurotrophin monomer fused to one chain (e.g., heavy chain) of an antibody, e.g., of the HIRMAb, and another neurotrophin monomer fused to the second chain of the antibody. Typically, the molecular weight range of recombinant proteins that may be fused to the molecular Trojan horse ranges from 1000 Daltons to 500,000 Daltons.
In some embodiments, more than one type of structure capable of crossing the BBB, e.g., molecular Trojan horse, may be used. The different structures may be covalently attached to a single neurotherapeutic agent, e.g., a single neurotrophin such as GDNF, or multiple neurotherapeutics, e.g., multiple neurotrophins, or any combination thereof. Thus, for example, in some embodiments either with the same neurotrophin attached to each MTH or a different neurotrophin attached, or combinations of neurotrophins attached. Thus the neuroprotective recombinant protein can be fused to multiple molecular Trojan horses that undergo receptor-mediated transport across the blood-brain barrier, including monoclonal antibodies to the insulin receptor, transferrin receptor, insulin-like growth factor (IGF) receptor, or the low density lipoprotein (LDL) receptor or the endogenous ligand, including insulin, transferrin, the IGFs, or LDL. Ligands that traverse the blood-brain barrier via absorptive-mediated transport may also be used as molecular Trojan horses including cationic proteins, or carbohydrate bearing proteins that bind to membrane lectins. The molecular weight range of molecular Trojan horses is 1000 Daltons to 500,000 Daltons.
The covalent linkage between the structure capable of crossing the BBB and the neurotherapeutic agent may be direct, e.g., a peptide bond between the terminal amino acid of one peptide and the terminal amino acid of the other peptide to which it is linked, or indirect, via a linker. If a linker is used, it may be any suitable linker, e.g., a peptide linker. If a peptide linker is used, it may be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more than 10 amino acids in length. In some embodiments, a three amino acid linker is used. In some embodiments, the linker has the sequence ser-ser-met. The covalent linkage may be cleavable, however this is not a requirement for activity of the system in some embodiments; indeed, an advantage of these embodiments of the present invention is that the fusion protein, without cleavage, is partially or fully active both for transport and for activity once across the BBB.
In some embodiments, a noncovalent attachment may be used. An example of noncovalent attachment of the MTH, e.g., MAb, to the large molecule therapeutic neuroprotective factor is avidin/streptavidin-biotin attachment. Such an approach is further described in U.S. patent application Ser. No. 10/858,729, entitled “Anti-growth factor receptor avidin fusion proteins as universal vectors for drug delivery,” filed Apr. 21, 2005, which is hereby incorporated by reference in its entirety.
The neurotherapeutic agent may be any suitable neurothempeutic agent, such as a neurotrophin. In some embodiments, the neurotherapeutic agent is a neurotrophin such as brain derived neurotrophic factor (BDNF), nerve growth factor (NGF), neurotrophin-4/5, fibroblast growth factor (FGF)-2 and other FGFs, neurotrophin (NT)-3, erythropoietin (EPO), hepatocyte growth factor (HGF), epidermal growth factor (EGF), transforming growth factor (TGF)-α, TGF-β, vascular endothelial growth factor (VEGF), interleukin-1 receptor antagonist (IL-1ra), ciliary neurotrophic factor (CNTF), glial-derived neurotrophic factor (GDNF), neurturin, platelet-derived growth factor (PDGF), heregulin, neuregulin, artemin, persephin, interleukins, granulocyte-colony stimulating factor (CSF), granulocyte-macrophage-CSF, netrins, cardiotrophin-1, hedgehogs, leukemia inhibitory factor (LIF), midkine, pleiotrophin, bone morphogenetic proteins (BMPs), netrins, saposins, semaphorins, or stem cell factor (SCF). In some embodiments, the neurotrophin is BDNF. The BDNF may be native BDNF or a variant BDNF. Some embodiments utilize a two amino acid carboxyl-truncated variant. The BDNF can be a human BDNF. In some embodiments, the BDNF contains a sequence that is about 60, 70, 80, 90, 95, 99, or 100% identical to the sequence of amino acids 466-582 of SEQ ID NO: 24.
In some embodiments, the invention provides compositions containing a neurotherapeutic agent covalently linked to a structure that is capable of crossing the BBB where the composition is capable of producing an average elevation of concentration in the brain of the neurotherapeutic agent of at least about 1, 2, 3, 4, 5, 10, 20, 30, 40, or 50 ng/gram brain following peripheral administration, where the neurotherapeutic agent is a neurotrophin and the structure that is capable of crossing the BBB is a MAb to an endogenous BBB receptor mediated transport system. The antibody can be glycosylated or nonglycosylated; in some embodiments, the antibody is glycosylated, e.g., in a glycosylation pattern produced by its synthesis in a CHO cell. In certain embodiments, the neurotrophin is GDNF, e.g., a mature human GDNF (SEQ ID NO:52) or a sequence variant thereof. The MAb can be an antibody to the insulin BBB receptor mediated transport system, e.g., a chimeric MAb. The antibody can be a chimeric antibody with sufficient human sequence that it is suitable for administration to a human, e.g., at least about 80% human sequence, e.g., 85%, 90%, 95%, or another percent human amino acid sequence from about 80% to about 100% human sequence. In some embodiments, the insulin receptor is a human insulin receptor and the GDNF is a human GDNF. In some embodiments, the GDNF contains a sequence that is about 60, 70, 80, 90, 95, 99, or 100% identical to the sequence of SEQ ID NO: 44. The GDNF can be covalently linked at its amino terminus to the carboxy terminus of the heavy chain of the MAb, optionally with a linker between the termini, such as the three amino-acid linker ser-ser-met, or the two amino acid linker ser-ser. In some embodiments, the heavy chain of the MAb contains a sequence that is about 60, 70, 80, 90, 95, 99, or 100% identical to amino acids 20-462 of SEQ ID NO: 24. In some embodiments, the light chain of the MAb contains a sequence that is about 60, 70, 80, 90, 95, 99, or 100% identical to amino acids 21-234 of SEQ ID NO: 36.
The invention also provides compositions containing an agent that is covalently linked to a chimeric MAb to the human BBB insulin receptor. In some embodiments, the heavy chain of the MAb is covalently linked to the agent to form a fusion protein. The agent can be any agent described herein, i.e., any agent for which transport across the BBB is desired. In some embodiments, the agent is a therapeutic agent, such as a neurotherapeutic agent as described herein, e.g., a neurotrophin such as GDNF
Strikingly, it has been found that multifunctional fusion proteins of the invention, e.g., difunctional fusion proteins, retain a high proportion of the activity of the separate portions, e.g., the portion that is capable of crossing the BBB and the portion that is active in the CNS. Accordingly, the invention further provides a fusion protein containing a structure capable of crossing the BBB, covalently linked to a peptide that is active in the central nervous system (CNS), where the structure capable of crossing the BBB and the peptide that is active in the central nervous system each retain an average of at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 95, 99, or 100% of their activities, compared to their activities as separate entities. In some embodiments, the structure capapble of crossing the BBB, and the peptide that is active in the central nervous system each retain about 20% to about 80% of their activities (e.g., about 30% to about 70, or about 40% to about 60%) compared to their activities as separate entities. In some embodiments, the invention provides a fusion protein containing a structure capable of crossing the BBB, covalently linked to a peptide that is active in the central nervous system (CNS), where the structure capable of crossing the blood brain barrier and the peptide that is active in the central nervous system each retain an average of at least about 50% of their activities, compared to their activities as separate entities. In some embodiments, the invention provides a fusion protein containing a structure capable of crossing the BBB, covalently linked to a peptide that is active in the central nervous system (CNS), where the structure capable of crossing the blood brain barrier and the peptide that is active in the central nervous system each retain an average of at least about 60% of their activities, compared to their activities as separate entities. In some embodiments, the invention provides a fusion protein containing a structure capable of crossing the BBB, covalently linked to a peptide that is active in the central nervous system (CNS), where the structure capable of crossing the blood brain barrier and the peptide that is active in the central nervous system each retain an average of at least about 70% of their activities, compared to their activities as separate entities. In some embodiments, the invention provides a fusion protein containing a structure capable of crossing the BBB, covalently linked to a peptide that is active in the central nervous system (CNS), where the structure capable of crossing the blood brain barrier and the peptide that is active in the central nervous system each retain an average of at least about 80% of their activities, compared to their activities as separate entities. In some embodiments, the invention provides a fusion protein containing a structure capable of crossing the BBB, covalently linked to a peptide that is active in the central nervous system (CNS), where the structure capable of crossing the blood brain barrier and the peptide that is active in the central nervous system each retain an average of at least about 90% of their activities, compared to their activities as separate entities. In some embodiments, the structure capable of crossing the blood brain barrier retains at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 95, 99, or 100% of its activity, compared to its activity as a separate entity, and the peptide that is active in the central nervous system retains at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 95, 99, or 100% of its activity, compared to its activity as a separate entity.
As used herein, “activity” includes physiological activity, e.g., ability to cross the BBB and/or therapeutic activity and also binding affinity of the structures for their respective receptors.
Transport of the structure capable of crossing the BBB across the BBB may be compared for the structure alone and for the structure as part of a fusion structure of the invention by standard methods. For example, pharmacokinetics and brain uptake of the fusion structure, e.g., fusion protein, by a model animal, e g , a mammal such as a primate, may be used. Such techniques are illustrated in Example 7, which demonstrates pharmacokinetics and brain uptake of a fusion protein of the invention by the adult Rhesus monkey. Similarly, standard models for the function of an agent, e.g. the therapeutic or protective function of a therapeutic agent, may also be used to compare the function of the agent alone and the function of the agent as part of a fusion structure of the invention. See, e.g., Example 5, which demonstrates the activity of a neurotrophin alone and the same neurotrophin bound to a fusion protein in a model system (hypoxia-reoxygenation in human neural cells). In both Example 5 and Example 7, the fusion protein of the invention retained about 100% of the transport ability and the therapeutic function of its individual components, i.e., a structure capable of crossing the BBB (a MAb to the human insulin receptor) and a therapeutic agent (BDNF).
Alternatively, binding affinity for receptors may be used as a marker of activity. Binding affinity for the receptor is compared for the structure alone and for the structure when part of the fusion protein. A suitable type of binding affinity assay is the competitive ligand binding assay (CLBA). For example, for fusion proteins containing MAbs to endogenous BBB receptor-mediated transport systems fused to a neurotrophin, a CLBA may be used both to assay the affinity of the MAb for its receptor and the neurotrophin for its receptor, either as part of the fusion protein or as separate entities, and percentage affinity calculated. If, as in some embodiments, the peptide that is active in the CNS is highly ionic, e.g., cationic, causing a high degree of non-specific binding, suitable measures should be taken to eliminate the nonspecific binding. See, e.g., Example 4. “Average” measurements are the average of at least three separate measurements.
In embodiments of the above fusion proteins, the structure capable of crossing the blood brain barrier crosses the BBB on an endogenous BBB receptor-mediated transporter, such as a transporter selected from the group consisting of the insulin transporter, the transferrin transporter, the leptin transporter, the LDL transporter, and the IGF receptor. In some embodiments, the endogenous BBB receptor-mediated transporter is selected from the group consisting of the insulin transporter and the transferrin transporter. In some embodiments, the endogenous BBB receptor-mediated transporter is the insulin transporter, e.g., the human insulin transporter. The structure capable of crossing the BBB can be an antibody, e.g., a MAb such as a chimeric MAb. The antibody can be an antibody to an endogenous BBB receptor-mediated transporter, as described herein. The peptide that is active in the CNS can be a neurotherapeutic agent, e.g., a neurotrophin. In some embodiments, the neurotrophin is selected from the group consisting of brain-derived neurotrophic factor, nerve growth factor (NGF), neurotrophin-4/5, fibroblast growth factor (FGF)-2 and other FGFs, neurotrophin (NT)-3, erythropoietin (EPO), hepatocyte growth factor (HGF), epidermal growth factor (EGF), transforming growth factor (TGF)-α, TGF-β, vascular endothelial growth factor (VEGF), interleukin-1 receptor antagonist (IL-1ra), ciliary neurotrophic factor (CNTF), glial-derived neurotrophic factor (GDNF), neurturin, platelet-derived growth factor (PDGF), heregulin, neuregulin, artemin, persephin, interleukins, granulocyte-colony stimulating factor (CSF), granulocyte-macrophage-CSF, netrins, cardiotrophin-1, hedgehogs, leukemia inhibitory factor (LIF), midkine, pleiotrophin, bone morphogenetic proteins (BMPs), netrins, saposins, semaphorins, or stem cell factor (SCF). In some embodiments, the neurotrophin is BDNF such as a truncated BDNF, e.g., a carboxyl-truncated BDNF. The carboxyl-truncated BDNF is lacking the two carboxyl terminal amino acids in some embodiments. The structure capable of crossing the BBB and the neurotherapeutic agent are covalently linked by a peptide linker in some embodiments.
In certain embodiments, the invention provides compositions that increase the serum half-life of cationic substances. One limitation for many current therapeutics, especially cationic therapeutic peptides (e.g., BDNF) is their rapid clearance from the circulation. The positive charge on the cationic substance, such as cationic peptides, rapidly interacts with negative charges on cell membranes, which triggers an absorptive-mediated endocytosis into the cell, particularly liver and spleen. This is true not only for neurotherapeutics (where rapid clearance means only limited contact with the BBB and thus limited ability to cross the BBB) but for other agents as well, such as cationic import peptides such as the tat peptide, or cationic proteins (e.g. protamine, polylysine, polyarginine) that bind nucleic acids, or cationic proteins such as avidin that bind biotinylated drugs. Surprisingly, fusion compositions of the invention that include a cationic therapeutic peptide covalently linked to an immunoglobulin show greatly enhanced serum half-life compared to the same peptide when it was not covalently part of a fusion immunoglobulin. This is an important finding, because it shows that the fusion of a highly cationic protein, e.g., BDNF, to an immunoglobulin, e.g. HIRMAb, has two important and unexpected effects: 1) it greatly enhances the serum half-life of the cationic protein, and 2) it does not accelerate the blood clearance of the immunoglobulin to which it is attached, e.g., the HIRMAb. Prior work shows that the noncovalent attachment of a cationic therapeutic peptide, e.g., the cationic BDNF to a monoclonal antibody greatly accelerated the blood clearance of the antibody, owing to the cationic nature of the BDNF, which greatly enhances hepatic uptake. The work in
Accordingly, in some embodiments, the invention provides composition comprising a cationic therapeutic peptide covalently linked to an immunoglobulin, wherein the cationic therapeutic peptide in the composition has a serum half-life that is an average of at least about 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, or more than about 100-fold greater than the serum half-life of the cationic therapeutic peptide alone. In some embodiments, the invention provides a composition comprising a cationic therapeutic peptide covalently linked to an immunoglobulin, wherein the cationic therapeutic peptide in the composition has a mean residence time (MRT) in the serum that is an average of at least about 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, or more than about 100-fold greater than the serum half-life of the cationic therapeutic peptide alone. In some embodiments, the invention provides composition comprising a cationic therapeutic peptide covalently linked to an immunoglobulin, wherein the cationic therapeutic peptide in the composition has a systemic clearance rate that is an average of at least about 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, or more than about 100-fold slower than the systemic clearance rate of the cationic therapeutic peptide alone. In some embodiments, the invention provides composition comprising a cationic therapeutic peptide covalently linked to an immunoglobulin, wherein the cationic therapeutic peptide in the composition has average blood level after peripheral administration that is an average of at least about 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, or more than about 100-fold greater than the average blood level after peripheral administration of the cationic therapeutic peptide alone.
In some embodiments, the cationic therapeutic peptide comprises a neurotherapeutic agent. Examples of neurotherapeutic agents that are cationic peptides interferons, interleukins, cytokines, or growth factors with an isoelectric point (pI) above 8. In some embodiments, the neurotherapeutic agent is a neurotrophin. Cationic peptide neurotrophins include BDNF, GDNF, NT-3, NT-4/5, NGF, and FGF-2. In some embodiments, the neurotrophin is BDNF or GDNF.
In some embodiments, the immunoglobulin is an antibody to an endogenous BBB receptor-mediated transport system. In some embodiments, the endogenous BBB receptor-mediated transport system is selected from the group consisting of the insulin BBB transport system, the BBB transferrin receptor, the BBB leptin receptor, the BBB IGF receptor, or the BBB lipoprotein receptor. In some embodiments, the antibody is an antibody to the endogenous insulin BBB receptor-mediated transport system. Antibodies can be any suitable antibody as described herein.
Pharmaceutical compositions The invention also provides pharmaceutical compositions that contain one or more compositions of the invention and a pharmaceutically acceptable excipient. A thorough discussion of pharmaceutically acceptable carriers/excipients can be found in Remington's Pharmaceutical Sciences, Gennaro, A R, ed., 20th edition, 2000: Williams and Wilkins PA, USA. Pharmaceutical compostions of the invention include compositions suitable for administration via any peripheral route, including intravenous, subcutaneous, intrmuscular, intraperitoneal injection; oral, rectal, transbuccal, pulmonary, transdermal, intranasal, or any other suitable route of peripheral administration.
The compostions of the invention are particular suited for injection, e.g., as a pharmaceutical composition for intravenous, subcutaneous, intramuscular, or intraperitonal administration. Aqueous compositions of the present invention comprise an effective amount of a composition of the present invention, which may be dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium. The phrases “pharmaceutically or pharmacologically acceptable” refer to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to an animal, e g , a human, as appropriate. As used herein, “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions.
Exemplary pharmaceutically acceptable carriers for injectable compositions can include salts, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like. For example, compositions of the invention may be provided in liquid form, and formulated in saline based aqueous solution of varying pH (5-8), with or without detergents such polysorbate-80 at 0.01-1%, or carbohydrate additives, such mannitol, sorbitol, or trehalose. Commonly used buffers include histidine, acetate, phosphate, or citrate. Under ordinary conditions of storage and use, these preparations can contain a preservative to prevent the growth of microorganisms. The prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol; phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate, and gelatin
For human administration, preparations meet sterility, pyrogenicity, general safety, and purity standards as required by FDA and other regulatory agency standards The active compounds will generally be formulated for parenteral administration, e.g., formulated for injection via the intravenous, intramuscular, subcutaneous, intralesional, or intraperitoneal routes. The preparation of an aqueous composition that contains an active component or ingredient will be known to those of skill in the art in light of the present disclosure. Typically, such compositions can be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for use in preparing solutions or suspensions upon the addition of a liquid prior to injection can also be prepared; and the preparations can also be emulsified.
Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, methods of preparation include vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective. The formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, but drug release capsules and the like can also be employed
The term “unit dose” refers to physically discrete units suitable for use in a subject, each unit containing a predetermined-quantity of the therapeutic composition calculated to produce the desired responses, discussed above, in association with its administration, i.e., the appropriate route and treatment regimen. The quantity to be administered, both according to number of treatments and unit dose, depends on the subject to be treated, the state of the subject and the protection desired. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
The active therapeutic agents may be formulated within a mixture to comprise about 0.0001 to 1 0 milligrams, or about 0.001 to 0.1 milligrams, or about 1.0 to 100 milligrams or even about 0.01 to 1.0 grams per dose or so. Multiple doses can also be administered. In some embodiments, a dosage of about 2.5 to about 25 mg of a fusion protein of the invention is used as a unit dose for administration to a human, e g , about 2.5 to about 25 mg of a fusion protein of GDNF and a HIR MAb.
In addition to the compounds formulated for parenteral administration, such as intravenous or intramuscular injection, other alternative methods of administration of the present invention may also be used, including but not limited to intradermal administration (See U.S. Pat. Nos. 5,997,501; 5,848,991; and 5,527,288), pulmonary administration (See U.S. Pat. Nos. 6,361,760; 6,060,069; and 6,041,775), buccal administration (See U.S. Pat. Nos. 6,375,975; and 6,284,262), transdermal administration (See U.S. Pat. Nos. 6,348,210; and 6,322,808) and transmucosal administration (See U.S. Pat. No. 5,656,284). All such methods of administration are well known in the art. One may also use intranasal administration of the present invention, such as with nasal solutions or sprays, aerosols or inhalants. Nasal solutions are usually aqueous solutions designed to be administered to the nasal passages in drops or sprays. Nasal solutions are prepared so that they are similar in many respects to nasal secretions. Thus, the aqueous nasal solutions usually are isotonic and slightly buffered to maintain a pH of 5.5 to 6.5. In addition, antimicrobial preservatives, similar to those used in ophthalmic preparations and appropriate drug stabilizers, if required, may be included in the formulation. Various commercial nasal preparations are known and include, for example, antibiotics and antihistamines and are used for asthma prophylaxis.
Additional formulations, which are suitable for other modes of administration, include suppositories and pessaries. A rectal pessary or suppository may also be used. Suppositories are solid dosage forms of various weights and shapes, usually medicated, for insertion into the rectum or the urethra. After insertion, suppositories soften, melt or dissolve in the cavity fluids. For suppositories, traditional binders and carriers generally include, for example, polyalkylene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in any suitable range, e.g., in the range of 0.5% to 10%, preferably 1%-2%.
Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations, or powders. In certain defined embodiments, oral pharmaceutical compositions will comprise an inert diluent or assimilable edible carrier, or they may be enclosed in a hard or soft shell gelatin capsule, or they may be compressed into tablets, or they may be incorporated directly with the food of the diet. For oral therapeutic administration, the active compounds may be incorporated with excipients and used in the form of ingestible tablets, buccal tables, troches, capsules, elixirs, suspensions, syrups, wafers, and the like. Such compositions and preparations can contain at least 0.1% of active compound. The percentage of the compositions and preparations may, of course, be varied, and may conveniently be between about 2 to about 75% of the weight of the unit, or between about 25-60%. The amount of active compounds in such therapeutically useful compositions is such that a suitable dosage will be obtained.
The tablets, troches, pills, capsules and the like may also contain the following: a binder, such as gum tragacanth, acacia, cornstarch, or gelatin; excipients, such as dicalcium phosphate; a disintegrating agent, such as corn starch, potato starch, alginic acid and the like; a lubricant, such as magnesium stearate; and a sweetening agent, such as sucrose, lactose or saccharin may be added or a flavoring agent, such as peppermint, oil of wintergreen, or cherry flavoring. When the dosage unit form is a capsule, it may contain, in addition to materials of the above type, a liquid carrier. Various other materials may be present as coatings or to otherwise modify the physical form of the dosage unit. For instance, tablets, pills, or capsules may be coated with shellac, sugar or both. A syrup of elixir may contain the active compounds sucrose as a sweetening agent, methylene and propyl parabens as preservatives, a dye and flavoring, such as cherry or orange flavor. In some embodiments, an oral pharmaceutical composition may be enterically coated to protect the active ingredients from the environment of the stomach; enteric coating methods and formulations are well-known in the art.
VI. Nucleic Acids, Vectors, Cells, and Manufacture.
The invention also provides nucleic acids, vectors, cells, and methods of production.
A. Nucleic Acids
In some embodiments, the invention provides nucleic acids that code for proteins or peptides of the invention. In certain embodiments, the invention provides a single nucleic acid sequence containing a first sequence coding for a light chain of an immunoglobulin and second sequence coding a heavy chain of the immunoglobulin, where either the first sequence also codes for a peptide that is expressed as a fusion protein of the peptide covalently linked to the light chain, or the second sequence also codes for a peptide that is expressed as a fusion protein of the peptide covalently linked to the heavy chain In some embodiments, the invention provides nucleic acid sequences, and in some embodiments the invention provides nucleic acid sequences that are at least about 60, 70, 80, 90, 95, 99, or 100% identical to a particular nucleotide sequence. For example, in some embodiments, the invention provides a nucleic acid containing a first sequence that is at least about 60, 70, 80, 90, 95, 99, or 100% identical to SEQ ID NO:45and a second sequence that is at least about 60, 70, 80, 90, 95, 99, or 100% identical to nucleotides 1396-1746 of SEQ ID NO: 33.
In other embodiments, the invention provides a nucleic acid containing a sequence that is at least about 60, 70, 80, 90, 95, 99, or 100% identical to SEQ ID NO:45.
For sequence comparison, of two nucleic acids, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
A “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, including but not limited to, by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman (1988) Proc. Nat'l. Acad. Sci. USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Ausubel et al., Current Protocols in Molecular Biology (1995 supplement)).
One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1977) Nuc. Acids Res. 25:3389-3402, and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) or 10, M=5, N=−4 and a comparison of both strands. The BLAST algorithm is typically performed with the “low complexity” filter turned off. The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
The invention provides nucleic acids that code for any of the peptides of the invention. In some embodiments, the invention provides a single nucleic acid sequence containing a gene coding for a light chain of an immunoglobulin and a gene coding for a fusion protein, where the fusion protein includes a heavy chain of the immunoglobulin covalently linked to a peptide. In some embodiments, the peptide is a therapeutic peptide. In some embodiments the peptide is a neurothempeutic peptide, e.g., a neurotrophin such as BDNF or GDNF (e.g., mature human GDNF). In some embodiments, the BDNF is a two amino acid carboxy-truncated BDNF. In some embodiments, the immunoglobulin is an IgG. In some embodiments, the IgG is a MAb, such as a chimeric MAb. The antibody can be an antibody to a transport system, e.g., an endogenous BBB receptor-mediated transport system such as the endogenous BBB receptor-mediated insulin transport system. In some embodiments, the endogenous BBB receptor-mediated insulin transport system is a human endogenous BBB receptor-mediated insulin transport system and wherein the peptide to which the immunoglobulin heavy chain is covalently linked is human BDNF or human GDNF. Any suitable peptide, neurotherapeutic peptide, neurotrophin, BDNF, GDNF (e.g., mature human GDNF), antibody, monoclonal antibody, or chimeric antibody, as described herein, may be coded for by the nucleic acid, combined as a fusion protein and coded for in a single nucleic acid sequence. As is well-known in the art, owing to the degeneracy of the genetic code, any combination of suitable codons may be used to code for the desired fusion protein. In addition, other elements useful in recombinant technology, such as promoters, termination signals, and the like, may also be included in the nucleic acid sequence. Such elements are well-known in the art. In addition, all nucleic acid sequences described and claimed herein include the complement of the sequence.
In some embodiments the nucleic acid codes for a BDNF, e.g., a variant BDNF, or GDNF (e.g., mature human GDNF) as a component of the fusion protein, which also comprises an immunoglobulin sequence. In some embodiments, the BDNF contains a sequence that is about 60, 70,80, 90, 95, 99, or 100% identical to the sequence of amino acids 466-582 of SEQ ID NO: 24. In some embodiments, the GDNF contains a sequence that is at least about 60, 70,80, 90, 95, 99, or 100% identical to the sequence of SEQ ID NO:52. In some embodiments, the amino acid sequence of the encoded GDNF consists essentially of SEQ ID NO:52. In some embodiments, the nucleic acid codes for a fusion protein comprising an amino acid sequence that is at least about 60, 70,80, 90, 95, 99, or 100% identical to the sequence of SEQ ID NO:46. In some embodiments, the encoded nucleic acid comprises the amino acid sequence of SEQ ID NO:46. In some embodiments, the BDNF or GDNF is linked at its amino terminus to carboxy terminus of the heavy chain of the immunoglobulin, e.g., MAb. The heavy chain of the MAb can comprise a sequence that is about 60, 70, 80, 90, 95, 99 or 100% identical to amino acids 20-462 of SEQ ID NO: 24. In some embodiments, the light chain of the immunoglobulin, e.g., MAb, comprises a sequence that is about 60, 70, 80, 90, 95, 99 or 100% identical to amino acids 21-234 of SEQ ID NO: 36. The nucleic acid can further contain a nucleic acid sequence that codes for a peptide linker between the heavy chain of the MAb and the BDNF or GDNF. In some embodiments, the linker is S-S-M. The nucleic acid may further contain a nucleic acid sequence coding for a signal peptide, wherein the signal peptide is linked to the heavy chain Any suitable signal peptide, as known in the art or subsequently developed, may be used. In some embodiments, the signal peptide attached to the heavy chain comprises a sequence that is about 60, 70, 80, 90, 95, 99, or 100% identical to amino acids 1-19 of SEQ ID NO: 24. In some embodiments, the nucleic acid contains a nucleic acid sequence coding for another signal peptide, wherein the other signal peptide is linked to the light chain The signal peptide linked to the light chain can comprise a sequence that is about 60, 70, 80, 90, 95, 99, or 100% identical to amino acids 1-20 of SEQ ID NO: 36. The nucleic acid can contain a nucleic acid sequence coding for a selectable marker. In some embodiments the selectable marker is DHFR. The sequence of the DHFR can be about 60, 70, 80, 90, 95, 99, or 100% identical to amino acids 1-187 of SEQ ID NO: 38.
In certain embodiments, the invention provides a nucleic acid comprising a first sequence that codes for a neurotherapeutic peptide, e.g., a neurotrophin such as BDNF, in the same open reading frame as a second sequence that codes for an immunoglobulin component. The immunoglobulin component can be, e.g., a light chain or a heavy chain, e g , that is at least about 60, 70, 80, 90, 95, 99, or 100% identical to nucleotides 58-1386-of SEQ ID NO: 33 and a second sequence that is at least about 60, 70, 80, 90, 95, 99, or 100% identical to nucleotides 1396-1746 of SEQ ID NO: 33. In some embodiments, the nucleic acid also contains a third sequence that is at least about 60, 70, 80, 90, 95, 99, or 100% identical to nucleotides 61-702 of SEQ ID NO: 35. In some embodiments, the nucleic acid further contains a fourth sequence that codes for a first signal peptide and a fifth sequence that codes for a second signal peptide. In some embodiments, the fourth sequence is at least about 60, 70, 80, 90, 95, 99, or 100% identical to nucleotides 1-57 of SEQ ID NO: 33 and the fifth sequence is at least about 60, 70, 80, 90, 95, 99, or 100% identical to nucleotides 1-60 of SEQ ID NO: 35. In some embodiments, the nucleic acid further contains a sequence that codes for a selectable marker, such as dihydrofolate reductase (DHFR). In some embodiments, the sequence that codes for the DHFR is at least about 60, 70, 80, 90, 95, 99, or 100% identical to nucleotides 1-561 of SEQ ID NO: 37.
B. Vectors
The invention also provides vectors. The vector can contain any of the nucleic acid sequences described herein. In some embodiments, the invention provides a single tandem expression vector containing nucleic acid coding for an antibody heavy chain fused to a peptide, e.g., a therapeutic peptide such as a neurotrophin, and nucleic acid coding for a light chain of the antibody, all incorporated into a single piece of nucleic acid, e.g., a single piece of DNA. The single tandem vector can also include one or more selection and/or amplification genes. A method of making an exemplary vector of the invention is provided in the Examples. However, any suitable techniques, as known in the art, may be used to construct the vector.
The use of a single tandem vector has several advantages over previous techniques. The transfection of a eukaryotic cell line with immunoglobulin G (IgG) genes generally involves the co-transfection of the cell line with separate plasmids encoding the heavy chain (HC) and the light chain (LC) comprising the IgG. In the case of a IgG fusion protein, the gene encoding the recombinant therapeutic protein may be fused to either the HC or LC gene. However, this co-transfection approach makes it difficult to select a cell line that has equally high integration of both the HC and LC-fusion genes, or the HC-fusion and LC genes. The approach to manufacturing the fusion protein utilized in certain embodiments of the invention is the production of a cell line that is stably transfected with a single plasmid DNA that contains all the required genes on a single strand of DNA, including the HC-fusion protein gene, the LC gene, the selection gene, e.g. neo, and the amplification gene, e.g. the dihydrofolate reductase gene. As shown in the diagram of the fusion protein tandem vector in
C. Cells
The invention further provides cells that incorporate one or more of the vectors of the invention. The cell may be a prokaryotic cell or a eukaryotic cell. In some embodiments, the cell is a eukaryotic cell. In some embodiments, the cell is a mouse myeloma hybridoma cell. In some embodiments, the cell is a Chinese hamster ovary (CHO) cell. Exemplary methods for incorporation of the vector(s) into the cell are given in the Examples. However, any suitable techniques, as known in the art, may be used to incorporate the vector(s) into the cell. In some embodiments, the invention provides a cell capable of expressing an immunoglobulin fusion protein, where the cell is a cell into which has been introduced a single tandem expression vector, where both the immunoglobulin light chain gene and the gene for the immunoglobulin heavy chain fused to the therapeutic agent, are incorporated into a single piece of nucleic acid, e.g., DNA. In some embodiments, the invention provides a cell capable of expressing an immunoglobulin fusion protein, where the cell is a cell into which has been stably transfected a single tandem expression vector, where both the immunoglobulin heavy chain gene and the gene for the immunoglobulin light chain fused to the therapeutic agent, are incorporated into a single piece of nucleic acid, e.g., DNA. The introduction of the tandem vector may be by, e.g., permanent integration into the chromsomal nucleic acid, or by, e.g., introduction of an episomal genetic element.
D. Methods of Manufacture
In addition, the invention provides methods of manufacture. In some embodiments, the invention provides a method of manufacturing an immunoglobulin fusion protein, where the fusion protein contains an immunoglobulin heavy chain fused to a therapeutic agent, by introducing into a eukaryotic cell a single tandem expression vector, where both the immunoglobulin light chain gene and the gene for the immunoglobulin heavy chain fused to the therapeutic agent, are incorporated into a single piece of nucleic acid, e.g., DNA. In some embodiments, the invention provides a method of manufacturing an immunoglobulin fusion protein, where the fusion protein contains an immunoglobulin light chain fused to a therapeutic agent, by ly introducing into a eukaryotic cell a single tandem expression vector, where both the immunoglobulin heavy chain gene and the gene for the immunoglobulin light chain fused to the therapeutic agent, are incorporated into a single piece of nucleic acid, e.g., DNA. In some embodiments, the introduction of the vector is accomplished by integration into the host cell genome. In some embodiments, the introduction of the vector is accomplished by introduction of an episomal genetic element containing the vector into the host cell. Episomal genetic elements are well-known in the art In some embodiments, the therapeutic agent is a neurotherapeutic agent. In some embodiments, the single piece of nucleic acid further includes one or more genes for selectable markers. In some embodiments, the single piece of nucleic acid further includes one or more amplification genes. In some embodiments, the immunoglobulin is an IgG, e.g., a MAb such as a chimeric MAb. The methods may further include expressing the immunoglobulin fusion protein, and/or purifying the immunoglobulin fusion protein. Exemplary methods for manufacture, including expression and purification, are given in the Examples.
However, any suitable techniques, as known in the art, may be used to manufacture, optionally express, and purify the proteins. These include non-recombinant techniques of protein synthesis, such as solid phase synthesis, manual or automated, as first developed by Merrifield and described by Stewart et al. in Solid Phase Peptide Synthesis (1984). Chemical synthesis joins the amino acids in the predetermined sequence starting at the C-terminus. Basic solid phase methods require coupling the C-terminal protected a-amino acid to a suitable insoluble resin support. Amino acids for synthesis require protection on the a-amino group to ensure proper peptide bond formation with the preceding residue (or resin support). Following completion of the condensation reaction at the carboxyl end, the a-amino protecting group is removed to allow the addition of the next residue. Several classes of α-protecting groups have been described, see Stewart et al. in Solid Phase Peptide Synthesis (1984), with the acid labile, urethane-based tertiary-butyloxycarbonyl (Boc) being the historically preferred. Other protecting groups, and the related chemical strategies, may be used, including the base labile 9-fluorenylmethyloxycarbonyl (FMOC). Also, the reactive amino acid sidechain functional groups require blocking until the synthesis is completed. The complex array of functional blocking groups, along with strategies and limitations to their use, have been reviewed by Bodansky in Peptide Synthesis (1976) and, Stewart et al. in Solid Phase Peptide Synthesis (1984).
Solid phase synthesis is initiated by the coupling of the described C-terminal a-protected amino acid residue. Coupling requires activating agents, such as dicyclohexycarbodiimide (DCC) with or without 1-hydroxybenzo-triazole (HOBT), diisopropylcarbodiimide (DIIPC), or ethyldimethylaminopropylcarbodiimide (EDC). After coupling the C-terminal residue, the a-amino protected group is removed by trifluoroacetic acid (25% or greater) in dichloromethane in the case of acid labile tertiary-butyloxycarbonyl (Boc) groups. A neutralizing step with triethylamine (10%) in dichloro-methane recovers the free amine (versus the salt). After the C-terminal residue is added to the resin, the cycle of deprotection, neutralization and coupling, with intermediate wash steps, is repeated in order to extend the protected peptide chain Each protected amino acid is introduced in excess (three to five fold) with equimolar amounts of coupling reagent in suitable solvent. Finally, after the completely blocked peptide is assembled on the resin support, reagents are applied to cleave the peptide form the resin and to remove the side chain blocking groups. Anhydrous hydrogen fluoride (HF) cleaves the acid labile tertiary-butyloxycathonyl (Boc) chemistry groups. Several nucleophilic scavengers, such as dimethylsulfide and anisole, are included to avoid side reactions especially on side chain functional groups.
VII. Methods
The invention also provides methods. In some embodiments, the invention provides methods for transport of an agent active in the CNS across the BBB in an effective amount. In some embodiments, the invention provides therapeutic, diagnostic, or research methods. Diagnostic methods include the development of peptide radiopharmaceuticals capable of transport across the BBB, such as the fusion of a peptide ligand, or peptidomimetic MAb for an endogenous receptor in the brain, followed by the radiolabelling of the fusion protein, followed by systemic administration, and external imaging of the localization within the brain of the peptide radiopharmaceutical.
Prior to the present invention, neurotrophins such as BDNF or GDNF were injected directly into the brain to achieve a therapeutic effect, because the neurotrophin does not cross the BBB. Therefore, it is not expected that neurotrophic factors will have beneficial effects on brain disorders following the peripheral (intravenous, subcutaneous) administration of these molecules.
However, neurotherapeutics can be developed as drugs for peripheral routes of administration, providing the neurotherapeutic is enabled to cross the BBB. Attachment of the neurotherapeutic, e.g. a neurotrophin such as BDNF or GDNF to a MTH, e.g., the chimeric HIRMAb, offers a new approach to the non-invasive delivery of neurotherapeutics to the CNS in animals, e g , mammals such as humans for the treatment of acute brain and spinal cord conditions, such as focal brain ischemia, global brain ischemia, and spinal cord injury, and chronic treatment of neurodegenerative disease, including prion diseases, Alzheimer's disease (AD), Parkinson's disease (PD), Huntington's disease (HD), ALS, multiple sclerosis, transverse myelitis, motor neuron disease, Pick's disease, addiction (e.g., drug addiction), tuberous sclerosis, lysosomal storage disorders, Canavan's disease, Rett's syndrome, spinocerebellar ataxias, Friedreich's ataxia, optic atrophy, and retinal degeneration.
Accordingly, in some embodiments the invention provides methods of transport of an agent active in the CNS from the peripheral circulation across the BBB in an effective amount, where the agent is covalently attached to a structure that crosses the BBB, and where the agent alone is not transported across the BBB in an effective amount. In some embodiments the invention provides methods of transport of neurotherapeutic agent from the peripheral circulation across the BBB in a therapeutically effective amount, where the neurotherapeutic agent is covalently attached to a structure that crosses the BBB, and where the neurotherapeutic agent alone is not transported across the BBB in a therapeutically effective amount.
The invention also provides, in some embodiments, methods of treatment of disorders of the CNS by peripheral administration of an effective amount of a therapeutic agent, e.g., a neurotherapeutic agent covalently linked to a structure that is capable of crossing the BBB, where the agent alone is not capable of crossing the BBB in an effective amount when administered peripherally. In some embodiments, the CNS disorder is an acute disorder, and, in some cases, may require only a single administration of the agent. In some embodiments, the CNS disorder is a chronic disorder and may require more than one administration of the agent.
In some embodiments, the effective amount, e.g., therapeutically effective amount is such that a concentration in the brain is reached of at least about 0.001, 0.01, 0.1, 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 100, or more than 100 ng/gram brain. In some embodiments, a therapeutically effective amount, e.g., of a neurotrophin such as BDNF or GDNF, is such that a brain level is achieved of about 0.1 to 1000, or about 1-100, or about 5-50 ng/g brain. In some embodiments, the neurotherapeutic agent is a neurotrophin. In some embodiments, the neurotrophin is selected from the group consisting of BDNF, nerve growth factor (NGF), neurotrophin-4/5, fibroblast growth factor (FGF)-2 and other FGFs, neurotrophin (NT)-3, erythropoietin (EPO), hepatocyte growth factor (HGF), epidermal growth factor (EGF), transforming growth factor (TGF)-α, TGF-β, vascular endothelial growth factor (VEGF), interleukin-1 receptor antagonist (IL-1ra), ciliary neurotrophic factor (CNTF), glial-derived neurotrophic factor (GDNF), neurturin, platelet-derived growth factor (PDGF), heregulin, neuregulin, artemin, persephin, interleukins, granulocyte-colony stimulating factor (CSF), granulocyte-macrophage-CSF, netrins, cardiotrophin-1, hedgehogs, leukemia inhibitory factor (LIF), midkine, pleiotrophin, bone morphogenetic proteins (BMPs), netrins, saposins, semaphorins, or stem cell factor (SCF). In some embodiments, the neurotrophin is BDNF, e.g. a truncated BDNF, such as the carboxyl-truncated BDNFs described herein.
In some embodiments, the invention provides methods of treating a disorder of the CNS by peripherally administering to an individual in need of such treatment an effective amount of a neurotrophin, where the neurotrophin is capable of crossing the BBB to produce an average elevation of neurotrophin concentration in the brain of at least about 0.1, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 100, or more than 100 ng/gram brain following said peripheral administration, and where the neurotrophin remains at the elevated level for about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more than 10 days after a single administration. In some embodiments, the neurotrophin remains at a level of greater than about 1 ng/g brain, or about 2 ng/g brain, or about 5 ng/g brain for about 2, 3, 4, 5, 6, 7, 8, 9, 10, or more than 10 days after a single administration. In some embodiments, the neurotrophin is BDNF, including truncated versions thereof.
In some embodiments, the invention provides methods of treating a disorder of the CNS by peripherally administering to an individual in need of such treatment an effective amount of a composition of the invention. The term “peripheral administration,” as used herein, includes any method of administration that is not direct administration into the CNS, i.e., that does not involve physical penetration or disruption of the BBB. “Peripheral administration” includes, but is not limited to, intravenous intramuscular, subcutaneous, intraperitoneal, intranasal, transbuccal, transdermal, rectal, transalveolar (inhalation), or oral administration. Any suitable composition of the invention, as described herein, may be used. In some embodiments, the composition is a neurotrophin covalently linked to a chimeric HIR-MAb. In some embodiments, the neurotrophin is a BDNF. In some embodiments, the BDNF is a variant as described herein, such as a carboxyl-terminal truncated variant. In other embodiments, the neurotrophin is a GDNF (e.g., mature human GDNF).
A “disorder of the CNS” or “CNS disorder,” as those terms are used herein, encompasses any condition that affects the brain and/or spinal cord and that leads to suboptimal function. In some embodiments, the disorder is an acute disorder. Acute disorders of the CNS include focal brain ischemia, global brain ischemia, brain trauma, spinal cord injury, acute infections, status epilepticus, migrane headache, acute psychosis, suicidal depression, and acute anxiety/phobia. In some embodiments, the disorder is a chronic disorder. Chronic disorders of the CNS include chronic neurodegeneration, retinal degeneration, depression, chronic affective disorders, lysosmal storage disorders, chronic infections of the brain, brain cancer, stroke rehabilitation, inborn errors of metabolism, autism, mental retardation. Chronic neurodegeneration includes neurodegenerative diseases such as prion diseases, Alzheimer's disease (AD), Parkinson's disease (PD), Huntington's disease (HD), multiple sclerosis (MS), amyotrophic lateral sclerosis (ALS), transverse myelitis, motor neuron disease, Pick's disease, tuberous sclerosis, lysosomal storage disorders, Canavan's disease, Rett's syndrome, spinocerebellar ataxias, Friedreich's ataxia, optic atrophy, and retinal degeneration, and aging of the CNS.
In some embodiments, the invention provides methods of treatment of the retina, or for treatment or prevention of blindness. The retina, like the brain, is protected from the blood by the blood-retinal barrier (BRB). The insulin receptor is expressed on both the BBB and the BRB, and the HIRMAb has been shown to deliver therapeutics to the retina via RMT across the BRB. BDNF is neuroprotective in retinal degeneration, but it was necessary to inject the neurotrophin directly into the eyeball, because BDNF does not cross the BRB. In some embodiments, fusion proteins of the invention are used to treat retinal degeneration and blindness with a route of administration no more invasive than an intravenous or subcutaneous injection, because the HIRMAb delivers the BDNF across the BRB, so that the neurotrophin is exposed to retinal neural cells from the blood compartment.
In some embodiments, the invention provides a method of treatment for depression. A subset of patients with depression may have a brain deficiency of BDNF, and the correlation of single nucleotide polymorphisms (SNPs) with affective disorders has been reported. The direct injection of BDNF into the brain has durable anti-depressant effects in rodent model. The BDNF must be injected directly into the brain, because the neurotrophin does not cross the BBB. In some embodiments, the invention provides a method for treating depression by chronic administration of a fusion protein of the invention, thus elevating the brain levels of BDNF and being therapeutic in those patients with depression and a reduced production of brain BDNF.
Formulations and administration. Any suitable formulation, route of administration, and dose of the compositions of the invention may be used. Formulations, doses, and routes of administration are determined by those of ordinary skill in the art with no more than routine experimentation. Compositions of the invention, e.g., GDNF fusion proteins are typically administered in a single dose, e.g., an intravenous dose, of about 0.01-1000 mg, or about 0.05-500 mg, or about 0.1-100 mg, or about 1-100 mg, or about 0.5-50 mg, or about 5-50 mg, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 25, 30, 25, 40, 45, 50, 60, 70, 80, 90, or 100 mg. Typically, for the treatment of acute brain disease, such as stroke, cardiac arrest, spinal cord injury, or brain trauma, higher doses may be used, whereas for the treatment of chronic conditions such as Alzheimer's disease, Parkinson's disease, Huntington's disease, MS, ALS, transverse myelitis, motor neuron disease, Pick's disease, tuberous sclerosis, addiction (e.g., drug addiction), lysosomal storage disorders, Canavan's disease, Rett's syndrome, spinocerebellar ataxias, Friedreich's ataxia, optic atrophy, and retinal degeneration, and aging, lower, chronic dosing may be used. Oral administration can require a higher dosage than intravenous or subcutaneous dosing, depending on the efficiency of absorption and possible metabolism of the protein, as is known in the art, and may be adjusted from the foregoing based on routine experimentation.
For intravenous or subcutaneous administration, formulations of the invention may be provided in liquid form, and formulated in saline based aqueous solution of varying pH (5-8), with or without detergents such polysorbate-80 at 0.01-1%, or carbohydrate additives, such mannitol, sorbitol, or trehalose. Commonly used buffers include histidine, acetate, phosphate, or citrate.
Dosages for humans can be calculated from appropriate animal data. For example, human dosing of a BDNF-MAB conjugate is based on pre-clinical pharmacokinetic studies, and these measurements have been performed in 2 species, rats, and Rhesus monkeys. Prior work in 3 models of cerebral ischemia in rats demonstrated the range of effective doses of the BDNF-MAb conjugate is 5-50 μg/rat or 20-200 μg/kg of BDNF in the form of the BDNF-MAb conjugate. Since the BDNF component of the fusion protein molecule is 16%, and the HIRMAb component is 84%, the dose of fusion protein is 6-fold greater than the equivalent BDNF dose. Pharmacokinetic studies in rats show these doses produce a concentration of the BDNF in the form of conjugate in plasma of 50-500 ng/mL, and in brain of 5-50 ng/g. Pharmacokinetic studies in adult Rhesus monkeys with the HIRMAb show that the average plasma concentration in the first hour is 0.1% injected dose (ID)/mL, and that the brain concentration is 0.02% ID/g. The brain concentration of the fusion protein is about 0.01% ID/g (
The fusion protein may also be formulated for chronic use for the treatment of a chronic CNS disorder, e.g., neurodegenerative disease, stroke or brain/spinal cord injury rehabilitation, or depression. Chronic treatment may involve daily, weekly, bi-weekly administration of the composition of the invention, e.g., fusion protein either intravenously, intra-muscularly, or subcutaneous in formulations similar to that used for acute treatment. Alternatively, the composition, e.g., fusion protein may be formulated as part of a bio-degradable polymer, and administered on a monthly schedule.
Combination therapies. The composition of the invention, e.g., fusion protein may be administered as part of a combination therapy. The combination therapy involves the administration of a composition of the invention in combination with another therapy for the CNS disorder being treated. If the composition of the invention is used in combination with another CNS disorder method or composition, any combination of the composition of the invention and the additional method or composition may be used. Thus, for example, if use of a composition of the invention is in combination with another CNS disorder treatment agent, the two may be administered simultaneously, consecutively, in overlapping durations, in similar, the same, or different frequencies, etc. In some cases a composition will be used that contains a composition of the invention in combination with one or more other CNS disorder treatment agents.
Other CNS disorder treatment agents that may be used in methods of the invention include, without limitation, thromolytic therapy for stroke, amyloid-directed therapy for Alzheimers disease, dopamine restoration therapy for Parkinsons disease, RNA interference therapy for genetic disorders, cancer, or infections, and anti-convulsant therapy for epilepsy. Dosages, routes of administration, administration regimes, and the like for these agents are well-known in the art.
In some embodiments, the composition, e.g., fusion protein is co-administered to the patient with another medication, either within the same formulation or as a separate composition. For example, the fusion protein could be formulated with another fusion protein that is also designed to deliver across the human blood-brain barrier a recombinant protein other than BDNF (e.g., GDNF). The fusion protein may be formulated in combination with other large or small molecules.
VIII. Kits
Compositions of the invention, e.g., fusion proteins, may be provided as a kit that includes the formulation, e.g., fusion protein in a container and in suitable packaging. The composition can be provided in a dry powder form, in solid form (i.e., lyophilized), in solution, or in suspension. If the composition is a protein, to the proteins may have been added emulsifiers, salts, preservatives, other proteins, nucleic acids, protease inhibitors, antibiotics, perfumes, polysaccharides, adhesive agents, polymers, microfibrils, oils, etc. The composition is packaged for transport, storage and/or use by a consumer. Such packaging of therapeutic compositions for transport, storage, and use is well-known in the art. Packaged compositions may include further components for the dispensing and storage of the composition, and may also include separately packaged diluent comprised of, e.g., sterile water or a suitable buffer, for solubilizing the formulation, e.g., fusion protein prior to administration to the patient. Kits of the invention may also include written materials, including instructions for use, results of clinical studies, desired outcome and expected course of treatment, information about precautions and side effects, and the like. The kits may optionally further contain other components, such as gloves, scissors, tape, implements for disposal of used vials and other waste, masks, antiseptic, antibiotics, and the like.
EXAMPLES Example 1Construction of the Single Tandem Vector Containing Complete Genes for IgG-Neurotherapeutic Fusion
Genetic engineering of a eukaryotic expression vector encoding the heavy chain (HC) of the fusion protein is outlined in
DNA sequence analysis of the IgG promoter region revealed the presence of additional SspI sites in this region. Therefore, it was first necessary to release the HC promoter region (PRO-VH) by digestion of clone 404 with XhoI and NheI, and the clone 404 was re-closed with a XhoI-NheI linker which produced clone 405 (-Pro-VH). The sequence of the forward and reverse ODNs used to produce the XhoI-NheI linker are given in Table 1. Plasmid clone 405 (-Pro-VH) now carries the single SspI site introduced by SDM. The human vBDNF cDNA was subcloned at SspI to form an intermediate plasmid named clone 414 (not shown). The complete fusion protein HC expression cassette was then reconstructed by subcloning of the PRO-VH fragment previously deleted to form clone 415. The fusion protein HC gene was then subcloned in the eukaryotic expression vector, clone 400, at the BamHI site to form clone 416.
The vBDNF cDNA was produced by PCR via either of 2 equivalent approaches. In one approach, a prokaryotic expression plasmid, pHTBS01, isolated as an expressed sequence tag (EST), and encoding human BDNF, was digested with BamHI and BpII, and gel purified, and re-ligated with T4 ligase and the 5′-end linker to produce clone 412 (
Clone 412 was then digested with XhoI and BsiWI, and gel purified, and re-ligated with T4 ligase and the 3′end linker to produce clone 413 (
The nucleotide and amino acid sequence of the reconstructed carboxyl terminus at the CH3 region of the HIRMAb HC, a 3-amino acid linker (Ser-Ser-Met), the vBDNF sequence, followed by a stop codon is shown in
Clone 416 plasmid DNA was electroporated into mouse myeloma cells that had previously been transfected with an expression plasmid encoding the light chain (LC) of the chimeric HIRMAb. Since the vBDNF is fused only to the HC, there is no modification of the LC of the chimeric HIRMAb. Following selection of transfected cell lines, media from 96-well plates were screened with an ELISA comprised of 2 anti-human IgG antibodies; one antibody is directed against the heavy chain of human IgG1, and the other antibody is directed against human kappa light chains Myeloma clones encoding for intact fusion protein were isolated, and propagated in a 10 L bioreactor. However, the production levels of the fusion protein were low. This low production was attributed to several factors, including (i) transfection of the myeloma line by 3 separate expression plasmids encoding the heavy chain gene, the light chain gene, and the antibiotic resistance gene; and (ii) the use of genomic fragment of the heavy and light chain genes with large intronic sequences. Therefore, the fusion protein expression plasmid was re-engineered with the following features:
- (1) the polymerase chain reaction (PCR) was used to convert genomic fragments of the fusion protein HC and LC genes into ‘intron-less’ cDNA forms of the 2 genes
- (2) the cDNA forms the fusion protein HC and LC genes were placed on a single ‘tandem vector’ in which the 2 genes were placed in separate and tandem expression cassettes with separate promoters
- (3) the promoter driving the expression of the fusion protein HC and LC genes was changed from the human IgG promoters to the cytomegalovirus (CMV) promoter, to enable transfection of non-myeloma cells, such as Chinese hamster ovary (CHO) cells
- (4) the tandem vector encoding fusion protein contains a gene encoding for the dihydrofolate reductase (DHFR) gene, under a separate SV40 promoter, to allow for methotrexate (MTX) selection of CHO lines which contain amplification of the genome in the region of the insertion of the expression vector.
In order to produce the fusion protein tandem vector, it was first necessary to produce intermediate plasmids, which separately encode cDNA forms of the fusion protein HC and LC genes. Eukaryotic expression plasmids carrying the CMV promoter and the bovine growth hormone (BGH) poly-A (pA) transcription termination sequences, and designated pCD, were digested with NheI and XhoI and re-ligated with T4 ligase and an NheI-EcoRV-KpnI-ScaI-BamHI-XhoI linker, as shown in
The resulting plasmid, designated pCD-linker (
The fusion protein LC PCR product was digested with EcoRV and XhoI and subcloned into CD-linker to produce the clone 423a (
Clones 422a and 423a were the precursors to the fusion protein tandem vector, as outlined in
In step 2, the mutated clone 422a was digested with EcoRI, blunt-ended, and re-ligated with the EcoRI-HindIII-NotI-XcaI linker to produce clone 422a-I (
Electroporation of CHO cells with fusion protein tandem vector and cultivation in a bioreactor. The fusion protein tandem vector (
Purification and characterization of bioreactor produced fusion protein. The conditioned medium obtained from the bioreactor under perfusion mode was passed through a 1 μm filter, and the medium collected in a 200 L Bioprocess container under sterile conditions, which were maintained at 4° C. in a glass door refrigerator contiguous with the bioreactor. Then, 200 L batches of conditioned medium were passed through 1 μm and 0.4 μm pre-filters for the removal of cell debris. The medium was then concentrated with tangential flow filtration (TFF). The TFF system was a Pellicon 2 model from Millipore and was comprised of five 0.5 m2 filtration cassettes with a 30 kDa molecular weight cutoff and a total surface area of 2.5 m2. A transmembrane gradient of 15 PSI was produced, which results in a reduction in volume of the 200 L to 2 L within 2 hours. The concentrated medium was passed through an 0.22μ filter prior to elution through 100 mL Prosep A (Millipore) recombinant protein A affinity column. Following application of the sample, the column was washed with buffer A (0.025 M NaCl, 0.025 M Tris, pH=7.4, 3 mM EDTA). The elution of CHO cell host protein (CHOP) was monitored at A280 with a Shimadzu detector. The fusion protein was eluted with 0.1 M citric acid (pH=3) in tubes containing Tris base to cause immediate neutralization to pH 7. The neutralized acid eluate pool was diluted with double distilled water until the conductivity was <7 mS, and the material was applied to a 50 mL Sepharose SP cation exchange column (Amersham) that has been equilibrated with a 0.02 M Tris, pH=7.5. Following washing in the Tris buffer, the residual CHOP was separated from the fusion protein with a linear NaCl gradient from 0 to 1 M NaCl. The fusion protein peak was pooled and buffer exchanged and concentrated with a Millipore diafiltration unit with a 30 kDa molecular weight cutoff. The final concentrated antibody solution was sterile filtered (0.22 μm) and stored at 4° C. The fusion protein was purified to homogeneity on sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), as demonstrated in
The fusion protein is bi-functional and binds with high affinity to both the human insulin receptor and to the human trkB receptor. The affinity of the fusion protein for the HIR extracellular domain (ECD) was determined with a competitive ligand binding assay (CLBA) using the lectin affinity purified HIR ECD. CHO cells transfected with the HIR ECD were grown in serum free media (SFM), and the HIR ECD was purified with a wheat germ agglutinin affinity column. The HIR ECD was plated on Nunc-Maxisorb 96 well dishes and the binding of the murine HIRMAb to the HIR ECD was detected by radioactivity measurements following addition of [125I] murine HIRMAb as the ligand in the binding assay (
The TrkB CLBA was designed for measurement of the affinity of the fusion protein for recombinant human TrkB ECD. The design of a TrkB CLBA was made difficult by the cationic nature of BDNF, which causes a high degree of nonspecific binding in the assay and this reduces the sensitivity of the assay. The nonspecific binding of BDNF could be eliminated by conjugation of 2000 Da polyethyleneglycol (PEG) to the protein. A bifunctional PEG molecule, biotin-PEG2000-hydrazide (Hz), was commercially obtained, and conjugated to BDNF to produce BDNF-PEG2000-biotin, as outlined in
Neurotrophins such as BDNF require an obligatory formation of a homo-dimeric structure to be biologically active, and to bind with high affinity to the cognate receptor, e.g. TrkB. A naturally occurring homo-dimeric structure between two BDNF molecules was formed when the neurotrophin was fused to a carboxyl terminus of the CH3 region of an IgG molecule, as illustrated in
Human neural cells subjected to hypoxia are neuroprotected by the fusion protein with equal activity as recombinant BDNF. Human SH-SY5Y neural cells were exposed to 10 uM retinoic acid for 7 days, which induces gene expression of trkB, the BDNF receptor. The cells were then exposed to 16 hours of oxygen deprivation in a sealed chamber, with oxygen sensor. Excitotoxic neural damage was then induced by 4 hours of re-oxygenation (
High affinity binding of fusion protein to human blood-brain barrier insulin receptor in isolated human brain capillaries. Isolated human brain capillaries are used as an in vitro model system of the human BBB (
Pharmacokinetics and brain uptake of fusion protein by the adult Rhesus monkey. The fusion protein was tritiated with [3H]-N-succinimidyl propionate to a specific activity of 2.0 μCi/μg. A 5 year old female Rhesus monkey, weighing 5.2 kg, was administered by a single intravenous injection a dose of 746 μCi (373 μg), and serum was collected at multiple time points over a 180 min period. The serum glucose of the anesthetized, overnight-fasted primate was constant throughout the 180 min study period, and averaged 72±2 mg %, which indicates that the administration of the HIRMAb based fusion protein caused no interference of the endogenous insulin receptor, and had no effect on glycemia control.
The serum removed from the anesthetized Rhesus monkey was analyzed for total radioactivity (
The plasma pharmacokinetics analysis (
HIRMAb and the BDNF is removed from blood at the same rate as the original murine HIRMAb. This is an important finding, because it shows that the fusion of BDNF, a highly cationic protein, to the HIRMAb does not accelerate the blood clearance of the HIRMAb. Prior work shows that the attachment of the cationic BDNF to a monoclonal antibody greatly accelerates the blood clearance of the antibody, owing to the cationic nature of the BDNF, which greatly enhances hepatic uptake. The work in
The data in
Native BDNF is not transported across the BBB. Similarly, a [3H]-mouse IgG2a isotype control antibody was not transported across the BBB in the adult Rhesus monkey, as the brain volume of distribution (VD) of the IgG at 180 minutes after an intravenous injection was equal to the plasma volume, 18 μL/g (
The brain VD of the fusion protein was converted into ng fusion protein per gram brain, based on the specific activity of the [3H]-fusion protein, and this allowed for calculation of the total mass of fusion protein in the brain, 24±1 ng/g, as shown in
The data shows that: (1) the plasma mean residence time (MRT) of the fusion protein, 312 minutes, was 100-fold greater than the MRT for native BDNF, which was 3.0 minutes, and (2) the systemic clearance of the fusion protein, 0.94 mL/min/kg, was 39-fold slower than the systemic clearance of the BDNF, which was 37 mL/min/kg. In other words, the average blood level of the recombinant protein was up to 100-fold greater when the recombinant protein was re-formulated as an IgG fusion protein. Thus, fusion of the BDNF to the molecular Trojan horse had 2 benefits: (1) the molecular Trojan horse carried the BDNF across the blood-brain barrier (BBB), whereas the BDNF alone cannot cross the BBB, and (2) the molecular Trojan horse prevented the rapid loss from blood of the neurotrophin; BDNF by itself lasts only about 3 minutes in the blood. Both of these properties serve to enhance the pharmacological effect of the BDNF in brain following administration into the blood stream. See, e.g., Table 5.
Neuroprotection in regional brain ischemia by conjugates of BDNF and a BBB molecular Trojan horse. Numerous attempts have been made to develop neuroprotective agents for the treatment of acute stroke. There have been no successes to date because the neuroprotective drugs are either too toxic, in the case of certain small molecules, or ineffective, because the drug does not cross the BBB. BDNF is neuroprotective when injected directly in the brain in parallel with experimental stroke in rodents and regional brain ischemia. The BDNF must be injected across the skull bone into the brain, because this large molecule drug does not cross the BBB. Since the BBB is intact in the early hours after regional brain ischemia, and since BDNF does not cross the BBB, then there is no neuroprotective effect in the ischemic brain following the intravenous administration of BDNF alone. To deliver BDNF across the BBB, the neurotrophin was attached to a mouse MAb to the rat transferrin receptor (TfR). This peptidomimetic MAb carries BDNF across the BBB, and the combined BDNF-MAb conjugate is highly neuroprotective following delayed intravenous administration in experimental stroke, because the BDNF is able to cross the BBB and enter the brain from blood. Once inside the brain, and behind the BBB, the BDNF activates its cognate receptor, trkB, which then induces neuroprotection in ischemic neurons, and stops the apoptotic death cycle. The neuroprotective effect of the BDNF-MAb conjugate demonstrates a dose response effect, a time response effect, and is long-lasting, as the neuroprotection at 7 days is identical to the neuroprotection at 1 day after a single intravenous administration of the BDNF-MAb conjugate. See, e.g., Zhang and Pardridge (2001) Brain Res. 889:49-56, and Zhang and Pardridge (2001) Stroke 32:1378-1374, which are incorporated by reference herein in their entirety. The fusion protein would also be neuroprotective in human stroke, since the BDNF is fused to an MAb to the HIR, which rapidly binds to both the human BBB in vitro, and is rapidly transported across the primate BBB in vivo.
Example 9Neuroprotection in global brain ischemia of conjugates of BDNF and a BBB molecular Trojan horse. The direct injection of BDNF into the brain is also neuroprotective in transient forebrain ischemia (TFI), such as might occur after a cardiac arrest. However, intravenous BDNF is not neuroprotective in TFI, because the BDNF does not cross the BBB, and because the BBB is intact in the early hours after TFI, when neuroprotection is still possible. Conversely, intravenous BDNF was neuroprotective in TFI if the BDNF was attached to a mouse MAb against the rat transferrin receptor (TfR), which acts as a molecular Trojan horse to ferry the BDNF across the BBB and into brain. Adult rats were subjected to TFI, which resulted in a flat-line electroencephalogram (EEG) for approximately a 10-minute period. The animals were resuscitated and then administered 1 of 4 different therapeutics intravenously: (a) buffer, (b) unconjugated BDNF, (c) the receptor specific MAb without the BDNF attached, and (d) the BDNF-MAb conjugate. In the case of the animals treated with saline, unconjugated BDNF, or MAb alone, there was no neuroprotection of pyramidal neurons in the CA1 sector of hippocampus. However, in the case of the BDNF-MAb conjugate, there is complete normalization of CA1 pyramidal neuron density following delayed intravenous administration. See, e.g., Wu and Pardridge (199), PNAS (USA) 96:254-259, which is incorporated by reference herein in its entirety. This shows that BDNF is strongly neuroprotective in global brain ischemia following delayed intravenous administration, providing the BDNF is attached to a BBB molecular Trojan horse. The recombinant fusion protein of BDNF and a receptor specific MAb could be given following cardiac arrest to prevent permanent brain damage.
Example 10BDNF is neuroprotective in brain and spinal cord injury if the neurotrophin can access brain cells. BDNF is neuroprotective in brain injury, providing the neurotrophin is injected directly through the skull bone, because BDNF does not cross the BBB. BDNF is also neuroprotective in brain subjected to excitotoxic injury by neurotoxins, and is neuroprotective in brain infected with the human immune deficiency virus (HIV)-1. BDNF is also neuroprotective in acute spinal cord injury; however, the BDNF must be administered by direct infusion into the spinal canal, because the BDNF does not cross the blood-spinal cord barrier, which is the same as the BBB in the forebrain. In all these cases, the intravenous administration of BDNF would not be neuroprotective, because the BDNF does not cross the BBB, and the BBB is intact in brain injury in the early hours after the injury, when neuroprotection is still possible. Conversely, the BDNF fusion protein would be neuroprotective in these conditions following intravenous administration, because the BDNF is fused to the BBB molecular Trojan horse, and is able to penetrate the brain and spinal cord from the blood following peripheral administration.
Example 11BDNF is neuroprotective in chronic neurodegenerative conditions of brain if the neurotrophin can access brain cells. Neurotrophins, such as BDNF can be developed as drugs for peripheral routes of administration, providing the neurotrophin is enabled to cross the BBB. Fusion of BDNF to the chimeric HIRMAb offers a new approach to the non-invasive delivery of BDNF to the brain in humans for the chronic treatment of neurodegenerative disease, including prion diseases, Alzheimer's disease (AD), Parkinson's disease (PD), Huntington's disease (HD), ALS, transverse myelitis, motor neuron disease, Pick's disease, tuberous sclerosis, lysosomal storage disorders, Canavan's disease, Rett's syndrome, spinocerebellar ataxias, Friedreich's ataxia, optic atrophy, and retinal degeneration, and brain aging.
Example 12BDNF as a therapeutic in retinal degeneration and blindness. The retina, like the brain, is protected from the blood by the blood-retinal barrier (BRB). The insulin receptor is expressed on both the BBB and the BRB, and the HIRMAb has been shown to deliver therapeutics to the retina via RMT across the BRB (Zhang et al, (2003) Mol. Ther. 7: 11-18). BDNF is neuroprotective in retinal degeneration, but it was necessary to inject the neurotrophin directly into the eyeball, because BDNF does not cross the BRB. The fusion protein could be used to treat retinal degeneration and blindness with a route of administration no more invasive than an intravenous or subcutaneous injection, because the HIRMAb would deliver the BDNF across the BRB, so that the neurotrophin would be exposed to retinal neural cells from the blood compartment.
Example 13BDNF as a therapeutic for depression. A subset of patients with depression may have a brain deficiency of BDNF, and the correlation of single nucleotide polymorphisms (SNPs) with affective disorders has been reported. The direct injection of BDNF into the brain has durable anti-depressant effects in rodent model. The BDNF must be injected directly into the brain, because the neurotrophin does not cross the BBB. The chronic administration of the fusion protein would provide a means for elevating the brain levels of BDNF, and may be therapeutic in those patients with depression and a reduced production of brain BDNF.
Example 14Method of manufacturing IgG fusion proteins. The transfection of a eukaryotic cell line with immunoglobulin G (IgG) genes generally involves the co-transfection of the cell line with separate plasmids encoding the heavy chain (HC) and the light chain (LC) comprising the IgG. In the case of a IgG fusion protein, the gene encoding the recombinant therapeutic protein may be fused to either the HC or LC gene. However, this co-transfection approach makes it difficult to select a cell line that has equally high integration of both the HC and LC-fusion genes, or the HC-fusion and LC genes. The preferred approach to manufacturing the fusion protein is the production of a cell line that is transfected with a single plasmid DNA that contains all the required genes on a single strand of DNA, including the HC-fusion protein gene, the LC gene, the selection gene, e.g. neo, and the amplification gene, e.g. the dihydrofolate reductase gene. As shown in the diagram of the fusion protein tandem vector in
Construction and Use of GDNF-immunoglobulin fusion proteins. Glial-derived neurotrophic factor (GDNF) is a potent neuroprotective neurotrophin (Lin et al, Science 260:1130-1132 (1993)). GDNF could be developed as a neuroprotective drug for acute conditions, such as acute ischemic stroke, or chronic conditions, such as Parkinson's disease, or motor neuron disease, or post-stroke neural repair (Lapchak et al, Neuroscience 78:61-72 (1997); Kitagawa et al, Stroke 29:1417-1422 (1998); Bohn, Exp. Neurol. 190:263-275 (2004); Kobayashi, et al. Stroke 37:2361-2367 (2006)). However, GDNF, like other large molecule drugs, does not cross the blood-brain barrier (BBB) (Kastin et al, Neurosci Lett. 340:239-241(2003)). Owing to the BBB problem, prior human clinical trials with recombinant GDNF delivered the protein to brain via invasive trans-cranial routes, such as intra-cerebroventricular injection (Lang et al, Ann Neurol. 59:459-466 (2006)) or convention enhanced diffusion (Patel et al, Ann. Neurol. 57:298-302 (2005)). However, both approaches were limited by poor GDNF penetration into the brain, as well as adverse events related to the invasive drug delivery system.
Large molecule drugs, such as GDNF, could be delivered to brain non-invasively, via the trans-vascular route across the BBB with the use of molecular Trojan horse technology (Pardridge, Pharm. Res. 27:1733-1744 (2007)). A BBB molecular Trojan horse is an endogenous peptide, or receptor-specific peptidomimetic monoclonal antibody (MAb) that undergoes receptor-mediated transport across the BBB via endogenous peptide receptors, such as the transferrin receptor or the insulin receptor. Prior work has developed genetically engineered chimeric or humanized MAb's to the human insulin receptor (HIR), as molecular Trojan horses for the human brain (Boado et al, Biotechnol. Bioeng. 96:381-391 (2007)). The non-transportable protein therapeutic is fused to the heavy chain (HC) of the HIRMAb. It is essential that the genetically engineered fusion protein retain bi-functionality, and both bind with high affinity to the HIR, to cause BBB transport, and bind to the cognate receptor on brain cells, to induce the desired pharmacologic effect, once the fusion protein penetrates the brain.
The present studies described the genetic engineering of a fusion protein of the chimeric HIRMAb and human GDNF. The amino terminus of mature human GDNF is fused to the carboxyl terminus of the HC of the HIRMAb (
Materials and Methods
Cloning of GDNF cDNA
The human prepro GDNF cDNA (GenBank P39905) corresponding to amino acids Met¬¬1-Ile211 was cloned by the polymerase chain reaction (PCR) using the oligodexoynucleotides (ODNs) described in Table 6 and cDNA derived from reverse transcription of polyA+RNA isolated from human U87 glial cells. DNA sequence analysis was performed and the nucleic acid and amino acid sequences of the cloned human prepro GDNF are given in SEQ ID NOs:43 and 44, respectively.
The GDNF cDNA was cloned by PCR using 25 ng polyA+RNA-derived cDNA, 0.2 μM forward and reverse ODN primers (Table 6), 0.2 mM deoxynucleosidetriphosphates, and 2.5 U PfuUltra DNA polymerase (Stratagene, San Diego, Calif.) in a 50 μl Pfu buffer (Stratagene). The amplification was performed in a Mastercycler temperature cycler (Eppendorf, Hamburg, Germany) with an initial denaturing step of 95° C. for 2 min followed by 30 cycles of denaturing at 95° C. for 30 sec, annealing at 55° C. for 30 sec and amplification at 72° C. for 1 min; followed by a final incubation at 72° C. for 10 min. PCR products were resolved in 0.8% agarose gel electrophoresis, and the expected major single band of ˜0.6 kb corresponding to the human GDNF cDNA was produced (
Engineering of HIRMAb-GDNF Expression Vector
For the engineering of the pHIRMAb-GDNF heavy chain (HC) expression plasmid, the mature human GDNF cDNA (SEQ ID NO:51) corresponding to amino acids Ser¬78-Ile211 (SEQ ID NO:52) of full length human GDNF was cloned by PCR using the pCD-GDNF as template.
The PCR cloning reaction was performed as described above. The ODNs used for PCR are 5′-phosphorylated for direct insertion into the Hpal site of the pHIRMAb-HC expression plasmid (
The HIRMAb HC and LC cDNA expression cassettes are driven by the cytomegalovirus (CMV) promoter and contain the bovine growth hormone (BGH) polyadenylation (pA) sequence (
Transient Expression of HIRMAb-GDNF Fusion Protein in COS Cells
COS cells were dual transfected with pHIRMAb-LC and pHIRMAb-HC-GDNF using Lipofectamine 2000, with a ratio of 1:2.5, ug DNA:uL Lipofectamine. Following transfection, the cells were cultured in serum-free VP-SFM (Invitrogen, Carlsbad, Calif.). The conditioned serum free medium was collected at 3 and 7 days. The fusion protein was purified by protein A affinity chromatography.
Human IgG and GDNF ELISAs
Human IgG ELISA was performed in Immulon 2 high binding plates (Dynex Tech., Chantilly, Va.) with COS cell conditioned medium. A goat anti-human IgG primary antibody (Zymed-Invitrogen, Carlsbad, Calif.) was plated in 0.1 M NaHCO3 (100 μl, 2 μg/ml) and incubated for overnight at 4 C. Plates were washed 0.01 M Na2HPO4/0.15 M NaCl/pH=7.4/0.05% Tween-20 (PBST), and blocked with 1% gelatin in PBST for 30 min at 22° C. Plates were incubated with 100 μL/well of either human IgG1 standard or the fusion protein for 60 minutes at room temperature (RT). After washing with PBST, a goat anti-human kappa LC antibody conjugated to alkaline phosphatase (Sigma Chemical Co., St. Louis, Mo.) was plated for 60 min at 37° C. Color development was performed with p-nitrophenyl phosphate (Sigma) at pH=10.4 in the dark. The reaction was stopped with NaOH, and absorbance at 405 nm was measured in a BioRad ELISA plate reader. Human GDNF immunoreactivity in COS cell conditioned medium was measured with the double antibody sandwich GDNF E max Immunoassay System kit from Promega (Madison, Wis.).
SDS-PAGE and Western Blotting
The homogeneity of protein A purified fusion protein produced by COS cells was evaluated with a reducing 12% sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), followed by Coomasie Blue staining For Western blotting, immunoreactivity was tested with a primary rabbit antibody to human GDNF (Santa Cruz Biotechnology, Santa Cruz, Calif.) or a primary goat antiserum against human IgG heavy and light chains (Vector Labs, Burlingame, Calif.).
HIR Receptor Assay
The affinity of the fusion protein for the HIR extracellular domain (ECD) was determined with an ELISA using the lectin affinity purified HIR ECD. CHO cells transfected with the HIR ECD were grown in serum free media (SFM), and the HIR ECD was purified with a wheat germ agglutinin affinity column. The HIR ECD (0.2 μg/well) was plated on Immulon 2 high binding 96-well plates, and the binding of the chimeric HIRMAb, the HIRMAb-GDNF fusion protein, or human IgG1 to the HIR ECD was detected with a biotinylated goat anti-human IgG (H+L) antibody (0.3 μg/well), and the ABC Elite detection system (Vector Labs). The concentration that caused 50% binding to the HIR ECD, the ED50, was determined by non-linear regression analysis using the WinNonlin software.
GFRα1 Receptor Assay
Binding of recombinant GDNF (Peproatech, Rocky Hill, N.J.), the chimeric HIRMAb, or the HIRMAb-GDNF fusion protein to the ECD of recombinant human GFRα1 was measured with an ELISA. A mouse anti-human (MAH) IgG (Zymed-Invitrogen) was plated in 96-well plates overnight at 2 μg/well. Following aspiration, washing, and blocking with 1% bovine serum albumin (BSA), the Fc fusion of the human GFRα1 ECD (R&D Systems, Minneapolis, Minn.) was plated at 0.4 μg/well. Following an incubation at room temperature (RT) for 60 min, the wells were washed with PBST, and the GDNF, antibody, or fusion protein was plated for 2 hours at RT. Following washing in PBST, a goat anti-GDNF antibody (R&D Systems) was plated at 0.4 ug/well for 30 min at RT. Following washing in PBST, a conjugate of alkaline phosphatase (AP) and a rabbit anti-goat (RAG) IgG(H+L) (Vector Labs) was plated and detection at 405 nm was performed with an ELISA plate reader after color development with para-nitrophenylphosphate (Sigma Chemical Co.).
SK-N-MC Bio-Assay
Human neural SK-N-MC cells were dual transfected with the c-ret kinase and a luciferase reporter plasmid under the influence of the 5′-flanking sequence (FS) of the rat tyrosine hydroxylase (TH) gene. The cells were grown in collagen coated 24-well dishes to 70% confluency in Dulbecco's modified Eagle medium (DMEM) with 10% fetal bovine serum (FBS) and 400 μg/mL G418. To begin the assay, the medium was aspirated, and 400 μL/well of fresh DMEM/10% FBS was added along with either recombinant GDNF or fusion protein. After a 24 hour incubation at 37° C., the wells were aspirated, and the cells extracted with 200 μL/well of Luciferase Reporter Lysis buffer (Promega, Madison, Wis.). Following centrifugation, luciferase enzyme activity was measured in the lysate with a luminometer, and luciferase enzyme activity, reported as picogram (pg) of luciferase, was normalized per mg sample protein using the bicinchoninic acid (BCA) protein assay (Pierce Chemical Co., Rockford, Ill.).
SH-SY5Y Bio-Assay
Human neural SH-SY5Y cells were plated in 96 well plates in DMEM/Ham F12 (1:1) in 10% FBS and grown until the cells reached 70% confluency. The medium was supplemented with 10 μM retinoic acid to induce differentiation of the cells over a 10 day period. After cell differentiation, the medium was changed, and supplemented with either GDNF or HIRMAb-GDNF fusion protein at zero time, and cell proliferation was measured over the 5 days with the CellTiter 96® AQueous Non-Radioactive Cell Proliferation Assay (Promega), which uses the tetrazolium compound, (3-(4,5-dimethylthiazol-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2H-tetrazolium, inner salt; MTS), and the electron coupling reagent, phenazine methosulfate (PMS). Absorbance at 490 nm is a measure of formazan production, which is proportional to the number of viable cells.
Middle Cerebral Artery Occlusion Model
The permanent middle cerebral artery occlusion (MCAO) model was performed as described previously in adult Sprague-Dawley rats (Zhang and Pardridge, Brain Res. 889:49-56 (2001)). The right middle cerebral artery of the anesthetized rat was occluded by insertion of an intra-luminal 4-0 nylon suture; the suture was coated in 0.1% poly-L-lysine and dried at 60° C. for 1 hour. Within 15 minutes of the occlusion, the rat was treated with an intra-cerebral injection of either HIRMAb-GDNF fusion protein (130 μg in 10 μL) or an equal volume of saline. Since the fusion protein is 17% GDNF, the dose of fusion protein is equivalent to a dose of GDNF of 22 μg, which is a dose that causes pharmacological effects in the brain (Sullivan et al, 1998). The drug was injected into the brain under stereotaxic guidance with the following coordinates: 0.2 mm posterior to bregma, 4 0 mm lateral to the midline, and 5.0 mm deep from the dural surface. The arterial nylon suture was left in place for permanent occlusion of the middle cerebral artery. A total of 20 rats were used for the study; 9 rats (5 treated with saline and 4 treated with HIRMAb-GDNF) expired prematurely and were excluded from the study. The rats were allowed to recover, and were euthanized 24 hours later, and coronal sections of brain were prepared with a rat brain matrix (ASI Instruments, Warren, Mich.), followed by staining with 2% 2,3,5-triphenyltetrazolium chloride (TTC), as described previously (Zhang and Pardridge, Brain Res. 889:49-56 (2001)). TTC stains healthy brain red, and infarcted brain is colorless. The stained brain sections were scanned on a UMAX PowerLook II flatbed scanner, and the area of the hemispheric infarct volumes was determined with the NIH Image software. The volume of the infarct was computed from the area of the infarcted zone and length (2 mm) of the coronal slices of brain hemisphere (Zhang and Pardridge, Brain Res. 889:49-56 (2001)). The scanned color image was converted to an inverted grayscale image in Photoshop, so that infarcted brain appears black and healthy brain appears white.
The neurologic deficit was determined 24 hours after the occlusion, as described previously (Zhang and Pardridge, Stroke 32:1378-1384 (2001)), and scored as follows: 0, no deficit; 1, failure to extend contralateral forepaw fully; 2, decreased grip of contralateral forelimb while tail is pulled; 3, spontaneous circling to left; 4, walks only when stimulated with decreased level of consciousness.
Results
DNA sequencing of the expression cassette of the pCD-GDNF encompassed 1,752 nucleotides (nt), including a 715 nt CMV promoter, a 636 nt prepro GDNF open reading frame, and a 401 nt BGH sequence, which predicted a 211 amino acid human preproGDNF protein, including a 19 amino acid signal peptide with 100% identity with the known sequence for human GDNF (P39905). Transfection of COS cells with pCD-GDNF resulted in high levels of immunoreactive GDNF the medium at 3 and 7 days following transfection.
The cDNA corresponding to the 134 amino acid mature GDNF was amplified by PCR using the ODNs in Table 6 and the pCD-GDNF as template, and this cDNA was subcloned into the Hpal site of the pHIRMAb-HC plasmid, as outlined in
Dual transfection of COS cells with the pHIRMAb-GDNF and the pHIRMAb-LC resulted in medium human IgG levels of 2.0 μg/mL, as determined with a human Fc specific ELISA. The level of immunoreactive GDNF in the medium was measured with a GDNF-specific ELISA. The data from both the human IgG and human GDNF ELISAs are given in Table 7, and the medium levels are expressed as nM concentrations to allow for comparison of the 2 assays.
As shown in Table 7, the concentration of the HIRMAb-GDNF fusion protein the medium was the same irrespective of whether the human IgG or GDNF ELISA is used.
The HIRMAb-GDNF fusion protein was purified by protein A affinity chromatography. Following SDS-PAGE and Coomasie blue staining, the size of the light chain (LC) was the same for both the HIRMAb and the HIRMAb-GDNF fusion protein (
The affinity of the fusion protein for the HIR extracellular domain (ECD) was determined with a ligand binding assay using lectin affinity purified HIR ECD (Methods). There is comparable binding of either the chimeric HIRMAb or the HIRMAb-GDNF fusion protein for the HIR ECD with ED50 of 0.50±0.11 nM and 0.87±0.14 nM, respectively (
The affinity of either GDNF or the HIRMAb-GDNF fusion protein for the ECD of the human GFRα1 was measured with an ELISA, which is outlined in
The intra-cerebral injection of the HIRMAb-GDNF fusion protein caused a 77% reduction in hemispheric stroke volume, from 331±33 mm3 to 77±22 mm3 (mean±SE, n=5-6 rats per group), which was significant at the p<0.001 level (Student's t-test), as shown in
Discussion
The results of this study were consistent with the following conclusions. First, a bi-functional IgG-GDNF fusion protein was genetically engineered, wherein mature human GDNF was fused to the carboxyl terminus of the heavy chain (HC) of a chimeric HIRMAb (
GDNF is a member of the transforming growth factor (TGF)-α gene family, along with other neurotrophins, such as neuturin, persephin, or artemin. GDNF reacts with its cognate receptor, GFRα1, as a homo-dimer (Eketjall et al, 1999). Therefore, the GDNF fusion construct described in this work (
The fusion protein was secreted in high amounts to the medium by COS cells co-transfected with the HC expression plasmid, pHIRMAb-GDNF (
The HIRMAb-GDNF fusion protein retains high affinity binding to the human GFRα1 receptor, and the affinity constant of binding is comparable to that of recombinant GDNF (
The intra-cerebral injection of the HIRMAb-GDNF fusion protein in rat brain following permanent middle cerebral artery occlusion (MCAO) resulted in a 77% reduction in hemispheric stroke volume from 331±33 mm3 to 77±22 mm3 (p<0.001), as shown in
The HIRMAb-GDNF fusion protein could not be delivered to rat brain in the MCAO model following intravenous administration, because the HIRMAb part of the fusion protein is not reactive with the rodent insulin receptor. However, the HIRMAb is active in Old World primates, such as the Rhesus monkey (Pardridge et al, Pharm. Res. 12:807-816 (1995)). Recent work has shown that fusion proteins of the HIRMAb and brain-derived neurotrophic factor (Boado et al, Biotechnol. Bioeng. 97:1376-1386 (2007)), a single chain Fv antibody (Boado et al, Bioconjug Chem. 18:447-455 (2007)), or iduronidase, a lysosomal enzyme (Boado et al, Biotechnol Bioeng. 99: 475-484 (2008)), all are rapidly transported across the Rhesus monkey BBB in vivo. In the primate brain, the uptake of the fusion protein is approximately 1% of the injected dose (ID) (Boado et al, Biotechnol Bioeng. 99: 474-484 (2008)). Since the weight of the human brain is about 10-fold greater than the weight of the Rhesus monkey brain, it is expected that the brain uptake of the HIRMAb-GDNF fusion protein by the human brain will be about 0.1% of the ID. Given an injection dose of 25 mg, the expected brain concentration of the fusion protein is about 25 ng/gram human brain, which is equivalent to 5 ng/gram of GDNF, since the fusion protein is about 20% GDNF and 80% HIRMAb. The concentration of GDNF in the human brain is 0.2-1 ng/gram (Wiesenhofer et al, Acta Neuropathol. (Berl) 99:131-137 (2000)). Therefore, the dosing of 25 mg of the HIRMAb-GDNF fusion protein to a 60 kg human could result in pharmacologically significant increase in GDNF in the brain. In experimental Parkinson's disease, pharmacological effects are achieved with just a 3-fold increase in brain GDNF concentration (Eslamboli et al, J. Neurosci. 25:769-777 (2005)). Aberrant neuronal sprouting is induced when the brain GDNF concentration is increased >100-fold (Eslamboli et al, J. Neurosci. 25:769-777 (2005)).). However, such large increases in brain GDNF will not be produced by therapeutic dosing of the HIRMAb-GDNF fusion protein in humans.
In conclusion, these studies described the genetic engineering, transient expression in COS cells, and validation of a HIRMAb-GDNF fusion protein, which represents a re-engineering of this neurotrophin to enable transport across the human BBB in vivo. The fusion protein can be administered by systemic injection to humans for treatment of multiple neurologic disorders, including stroke, neural repair, Parkinson's disease, or motor neuron disease.
Example 16Expression of HIRMAb-GDNF Fusion Protein Following Stable Transfection of CHO Cells
A tandem vector (TV) encoding the HIRMAb-GDNF fusion protein was engineered as shown in
-
- 731 nt cytomegalovirus (CMV) promoter
- 9 nt Kozak sequence (GCCGCCACC)
- 705 nt open reading frame (orf) encoding the HIRMAb LC
- 291 nt bovine growth hormone (BGH) polyA (pA) sequence
- 23 nt linker
- 714 nt CMV promoter
- 9 nt Kozak sequence
- 1,797 ORF encoding the fusion gene of the HIRMAb HC and GDNF
- 296 nt BGH pA
- 254 SV40 promoter
- 9 nt Kozak sequence
- 564 murine DHFR orf
- 940 hepatitis B virus (HBV) pA
The HIRMAb-GDNF TV also included the expression cassette encoding neo, the neomycin resistance gene, to enable selection with G418 (
The HIRMAb-GDNF TV sequence encoded for a 579 amino acid (AA) HC fusion protein (SEQ ID NO 48), which was comprised of a 19 AA IgG signal peptide, the 443 AA HIRMAb HC, a 2 AA linker, and the 134 AA human GDNF. The predicted molecular weight (MW) of the non-glycosylated HC was 63,860 Daltons (Da) and the predicted isolectric point (pI) of the fusion HC protein was 9.03. The HIRMAb-GDNF TV sequence encoded for a 234 AA LC protein (SEQ ID NO 49), which was comprised of a 20 AA IgG signal peptide, and the 214 AA HIRMAb LC. The predicted MW of the LC was 23,398 Da and the predicted pI of the LC protein was 5.45. The HIRMAb-GDNF TV sequence encoded for a DHFR protein (SEQ ID NO 50), that had an AA sequence 100% identical with the known AA sequence of murine DHFR. The domain structure of the HC is shown in
Electroporation of CHO Cells.
DG44 CHO cells were grown in serum-free medium (SFM), containing 1× HT supplement (hypoxanthine and thymidine). DG44 CHO cells (5×106 viable cells) were electroporated with 5 μg PvuI-linearized TV plasmid DNA. The cell-DNA suspension is then incubated for 10 min on ice. Cells are electroporated with pre-set protocol for CHO cells, i.e., square wave with pulse of 15 msec and 160 volts. After electroporation, cells are incubated for 10 min on ice. The cell suspension is transferred to 50 ml culture medium and plated at 125 μl per well in 40×96-well plates (10,000 cells per well), and 4,000 wells per study.
Selection and Amplification with Methotrexate and Screening IgG ELISA.
Following electroporation (EP), the CHO cells were placed in the incubator at 37° C. and 8% CO2. Owing to the presence of the neo gen in the TV, transfected cell lines are initially selected with G418. The TV also contains the gene for DHFR, so the transfected cells were also selected with 20 nM methotrexate (MTX) and HT-deficient medium. Once visible colonies are detected at about 21 days after EP, the conditioned medium was sampled for human IgG by ELISA. Plates were removed from the incubator and transferred to the sterile hood where 100 μL samples were taken from each well using a Precision Pipettor system and transferred into a sterile 96-well tissue culture plate, which was then used for the human IgG ELISA. The media taken from the EP plates for the ELISA was replaced with 100 μL of SFM and cells were returned to the incubator at 37° C. and 8% CO2. Wells with high human IgG signals in the ELISA were transferred from the 96-well plate to a 24-well plate with 1 mL of SFM. The 24-well plates were returned to the incubator at 37° C. and 8% CO2. The following week IgG ELISA was performed on the clones in the 24-well plates. This was repeated through the 6-well plates to T75 flasks and finally to 60 mL and 125 mL square plastic bottles on an orbital shaker. After the cells adapted to the 60 mL bottle on the orbital shaker at 120 RPM they were transferred into a 125 mL plastic square bottle with 12 mL of SFM. At this stage, the final MTX concentration was 80 nM, and the medium IgG concentration, which is a measure of HIRMAb-GDNF fusion protein in the medium was >10 mg/L at a cell density of 106/mL.
Dilutional Cloning of CHO Cells.
Clones selected for dilutional cloning (DC) were removed from the orbital shaker in the incubator and transferred to the sterile hood. The cells were diluted to 500 mL in F-12K medium with 5% dialyzed fetal bovine serum (d-FBS) and penicillin/streptomycin, and the final dilution was 8 cells per mL, so that 4,000 wells in 40×96-well plates were plated at a cell density of 1 cell per well (CPW). After the cell suspension was prepared, within the sterile hood, a 125 μL aliquot was dispensed into each well of a 96-well plate using an 8-channel pipettor or a Precision Pipettor system. The plates were then returned to the incubator at 37° C. and 8% CO2. The cells diluted to 1 cell/well cannot survive without serum. On day 6 or 7, DC plates were removed from the incubator and transferred to the sterile hood where 125 μL of F-12K medium with 5% dialyzed fetal bovine serum (d-FBS) was added to each well. After this step, the selection media contained 5% d-FBS, 30 nM MTX and 0.25 mg/mL Geneticin. On day 21 after the initial 1 CPW plating, aliquots from each of the 4,000 wells were removed for human IgG ELISA, using robotics equipment. DC plates were removed from the incubator and transferred to the sterile hood, where 100 μL of media was removed per well of the 96-well plate and transferred into a new, sterile sample 96-well plate using an 8-channel pipettor or a Precision Pipettor system.
ELISA Screening of 4,000 Wells.
On day 20 after the initial 1 CPW plating, 44 96-well Immunoassay plates were plated with 100 μL of 1 μg/mL solution of Primary antibody, a mouse anti-human IgG in 0.1M NaHCO3. Plates were incubated overnight in the 4° C. Revco refrigerator. The following day, the plates were washed with 1× TBST 5 times, and 100 μL of 1 μg/mL solution of secondary antibody and blocking buffer were added. Immulon plates were washed with 1× TBST 5 times. 100 μL of 1 mg/mL of 4-nitrophenyl phosphate di(2-amino-2-ethyl-1,3-propanediol) salt in 0.1M glycine buffer were added to the Immulon 96-well Immunoassay plates using the BioTek uFill. Plates were read on a microplate reader. The assay produced IgG output data for 4,000 wells/experiment. The highest producing 24-48 wells were selected for further propagation.
Adaptation of Cloned Cells to Serum-Free Medium (SFM).
The highest producing 24-well plates from the 1 CPW DC transferred to the sterile hood were gradually subcloned through 6-well dishes, T75 flasks, and 125 mL square plastic bottles on an orbital shaker. During this process the serum was reduced to zero, at the final stage of centrifugation of the cells and resuspension in SFM.
Second Round Dilutional Cloning.
The above procedures were repeated with a second round of dilutional cloning, again at 0.5 cells/well (CPW). At this stage, approximately 40% of the wells showed any cell growth, and all wells showing growth also secreted human IgG. These results confirmed that on average only 1 cell is plated per well with these procedures, and that the CHO cell line originated from a single cell.
Downstream Processing and 3-Column Purification of the HIRMAb-GDNF Fusion Protein.
Following the second round of dilutional cloning, the highest producing cell line secreting the HIRMAb-GDNF fusion protein was propagated in serum-free medium to a total volume of 2,000 mL in several 1 L square plastic bottles on an orbital shaker. The HIRMAb-GDNF fusion protein was purified from the CHO cell conditioned medium using the following down-stream processing:
-
- Depth filtration with a 0.2 m2 0.65 um GF filter in series with an 0.05 m2 0.2 μm ultrafilter
- Volume reduction to 400 mL using a Pellicon-2 tangential flow filtration (TFF) system
- Ultra-filtration with a 0.2 mm ultra-filter and application to a 7 mL column of protein A. Following application to the column, the column was eluted with 1 M NaCl, which elutes DNA non-specifically absorbed to the column, and the product is eluted as a single peak with 0.1 M sodium acetate/pH=3.7. The acid eluate was neutralized with 1 M Tris base and concentrated to 5 mL.
- Cation exchange (CATEX) chromatography in bind-elute mode was performed with a 5 mL column of SP Sepharose FF equilibrated with 0.02 M MES and 0.05 M NaCl. The conductivity of the sample was reduced to <5 mS/cm prior to application to the column. The column was successively eluted with step gradients of 0.02 M MES/pH=5.5 containing 0 25 M NaCl, 0.35 M NaCl, 0.5 M NaCl, and 1M NaCl. The HIRMAb-GDNF fusion protein eluted in 0.5 M NaCl.
- Anion exchange (ANEX) chromatography in flow-through mode was performed with a 5 mL column of Q Sepharose FF equilibrated with 0.025 M MES/pH=5.5 and 0.05 M NaCl. The conductivity of the sample was reduced to <7 mS/cm. The HIRMAb-GDNF fusion protein eluted in the flow-through.
Biochemical Characterization of 3-Column Purified CHO Cell Derived HIRMAb-GDNF Fusion Protein.
The purity and potency of the CHO derived HIRMAb-GDNF fusion protein was assessed with the following procedures:
-
- (a) SDS-PAGE. The HIRMAb-GDNF fusion protein was purified to homogeneity based on reducing and non-reducing sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE). A characteristic “fingerprint” of the HIRMAb-GDNF fusion protein is the detection of 3 heavy chain glycoforms, which arise from differential glycosylation of the GDNF part of the fusion protein. This pattern is reproducible from run to run.
- (b) GDNF and human IgG Western blot. The CHO derived HIRMAb-GDNF fusion protein was electrophoresed on a 12% SDS-PAGE gel and blotted to nitrocellulose for Western blotting with primary antibodies to either human IgG (left panel,
FIG. 39 ), or to human GDNF (right panel,FIG. 39 ). Both the anti-human IgG antibody and the anti-human GDNF antibody reacted specifically with the heavy chain of the HIRMAb-GDNF fusion protein. - (c) Human insulin receptor (HIR) binding of AGT-190. The extracellular domain (ECD) of the HIR was purified by lectin affinity chromatography from serum free medium conditioned by CHO cells that were permanently transfected with the HIR ECD . The HIR ECD was plated in ELISA wells to bind the chimeric HIRMAb without GDNF fused and the HIRMAb-GDNF fusion protein. As shown in
FIG. 40 , the affinity of the CHO-derived HIRMAb-GDNF fusion protein binding to the HIR is high, and not significantly different from the binding of the chimeric HIRMAb. These data indicate the affinity of the HIRMAb for the HIR is not affected by the fusion of GDNF to the carboxyl terminus of the IgG. The binding constant (ED50) shown inFIG. 40 was determined by non-linear regression analysis of the binding isotherm. - (d) GFRa1 binding of the HIRMAb-GDNF fusion protein. The affinity of either GDNF or the HIRMAb-GDNF fusion protein for the GDNF receptor, GFRal, was determined with a specific ELISA format, which is outlined in
FIG. 33 . In this assay, GDNF binds with high affinity for the GFRal extracellular domain (ECD), and the affinity of the CHO-derived HIRMAb-GDNF fusion protein for the GFRa1 (ED50=1.44±0.07 nM) was comparable to GDNF (ED50=1.00±0.09 nM). - (e) GDNF bio-assay in rat brain in vivo. The intra-cerebral injection of GDNF in experimental stroke results in neuroprotection, as reflected in a reduced stroke volume. Therefore, the permanent middle cerebral artery occlusion (MCAO) model was used as a rapid in vivo bio-assay of CHO-derived HIRMAb-GDNF fusion protein neuroprotective properties in vivo, similar to that shown for the COS derived fusion protein (
FIG. 35 ). The intra-cerebral injection of the HIRMAb-GDNF fusion protein caused a 74% reduction in hemispheric stroke volume, from 338±33 mm3 to 87±27 mm3 (mean±SE, n=5-6 rats per group), which was significant at the p<0.001 level (Student's t-test). Similarly, the cortical stroke volume was reduced 80% from 238±25 mm3 to 48±18 mm3 (p<0.001), and the sub-cortical stroke volume was reduced 39% from 101±10 mm3 to 39±11 mm3 (p<0.025). The neurologic deficit score was 3.6±0.2 and 1.4±0.7 (mean±SE, n=5-6 rats per group) in the saline treated and CHO-derived HIRMAb-GDNF fusion protein treated rats, respectively, and this improvement in neurologic deficit was significant at the p<0.05 level. - (f) Size exclusion high performance liquid chromatography. The absence of aggregates in the purified HIRMAb-GDNF fusion protein was demonstrated with size exclusion chromatography (SEC) high performance liquid chromatography (HPLC) using a G3000 SWXL column, 0.78×30 cm and an HPLC pump at 0.5 mL/min with detection at 280 nm. As shown in
FIG. 41 , the CHO-derived HIRMAb-GDNF fusion protein elutes as a single peak, removed from the void volume, with no detectable aggregates. The absence of aggregates is also demonstrated by the native polyacrylamide gel electrophoresis (FIG. 42 ). - (g) Carbohydrate analysis. The CHO-derived HIRMAb-GDNF fusion protein was analyzed for neutral monosaccharide content and for the N-terminal oligopeptide fingerprint. The fusion protein is glycosylated at 3 different N-linked asparagine sites, including 1 site within the CH2 region and 2 sites within the GDNF region of the fusion protein heavy chain The neutral monosaccharide content (moles monosaccharide/mole fusion protein) was 7.7 for N-acetyl glucosamine, 5.3 for mannose, 2.3 for galactose, 1.6 for fucose, and 0.19 for N-acetyl galactosamine. These 4 sugars are organized as 1 of 4 different terminal structures, designated G0, G1(1,6), G1(1,3), or G2, depending on whether there is 0, 1, or 2 terminal galactose moieties, respectively. The profile for AGT-190 is G0>G1>G2, which is typical of CHO-derived recombinant proteins, and indicative of relative reduced terminal galactosylation. The glycosylation of HIRMAb-GDNF fusion protein on at least 3 different asparagine residues explains the heterogeneity of the heavy chain on Western blotting (
FIG. 39 ). - (h) Binding to human blood-brain barrier. Capillaries, which form the BBB in vivo, were isolated from human autopsy brain in a purified preparation as shown by light microscopy (
FIG. 43 ). The HIRMAb-GDNF fusion protein was radio-labeled by tritiation, and a radio-receptor assay was performed to demonstrate binding of the labeled HIRMAb-GDNF fusion protein to the HIR at the human BBB, using the isolated human brain capillaries. There was a high level of binding of the HIRMAb-GDNF fusion protein to the human brain capillary and the binding was displaced by unlabeled murine HIRMAb (FIG. 43B ).
Treatment of Parkinson's Disease with the HIRMAb-GDNF Fusion Protein
Parkinson's disease (PD) is a neurodegenerative condition that affects the dopaminergic neurons of the nigral-striatal tract. GDNF is a potent trophic factor for these dopaminergic neurons. The intra-cerebral injection of the GDNF protein into the brain of rats with experimental PD can protect these neurons, and blocks further axotomy of the fibers projecting from the substantia nigra to the striatum. Accordingly, recombinant human GDNF has been developed as a new therapeutic for PD. However, GDNF does not cross the BBB. Therefore, GDNF was administered via a trans-cranial route using intra-cerebroventricular (ICV) injection. However, GDNF delivered by ICV injection was found to not penetrate into the brain parenchyma and was ineffective in patients with PD, and this delivery approach was abandoned. Subsequently, GDNF has been administered by convection enhanced diffusion (CED). In this approach, a reservoir holding the GDNF is implanted in the abdomen, and a catheter is run through the skin from the reservoir to the brain via a trans-cranial passage. The reservoir has a pump that continuously pumps the GDNF fluid into the brain. However, this highly invasive procedure was found to lead to toxic effects in the brain, was not effective owing to lack of penetration of the GDNF to the nigra-striatal tract, and was abandoned. These failed trans-cranial approaches to the treatment of PD with GDNF highlighted the importance of re-engineering this neurotrophin so that the molecule can cross the BBB. The trans-BBB delivery route has two unique advantages. First, the GDNF can be given by a non-invasive systemic injection, such as an intravenous, subcutaneous, or intra-muscular injection, and no neurosurgical procedure is required. Second, the GDNF enters the brain via the trans-vascular route. Since every neuron in the brain is perfused by its own blood vessel, the GDNF is delivered to every cell comprising the nigra-striatal tract of brain. The GDNF could be given on a weekly or bi-weekly basis to patients with PD at doses ranging from 1, 3, 10, 30, or 100 mg. The considerations in Example 7 suggest that 25-30 mg may be a preferred dose.
Example 18Acute and Chronic Treatment of Stroke with the HIRMAb-GDNF Fusion Protein
GDNF is highly neuroprotective in experimental stroke (Kitagawa et al, Stroke 29:1417-1422 (1998)). Activation of the GDNF receptor, GFRα1, inhibits apoptosis in the neuron that is induced by an ischemic event. The demonstration of GDNF's neuroprotective effects in experimental stroke have uniformly involved intra-cerebral injection of the neurotrophin, because the GDNF does not cross the BBB, and because the BBB is intact in the first 5 hours after stroke, when the rescue of dying neurons is still possible. The HIRMAb-GDNF is a re-engineered form of GDNF that is both equi-potent with GDNF as a neuroprotective agent, and is able to cross the human BBB following systemic administration. Thus, the patient suffering from an acute stroke could be rapidly treated with intravenous HIRMAb-GDNF in the emergency room. The HIRMAb-GDNF fusion protein will rapidly enter the brain and activate GFRα1 receptors on neurons to inhibit the apoptosis cycle induced by the stroke. In addition, chronic treatment with systemic HIRMAb-GDNF fusion protein could be therapeutic in the rehabilitation phase of stroke, since the intra-cerebral infusion of GDNF into the post-stroke brain induces neurogenesis, and neural repair in the post-stroke period (Kobayashi et al, 2006).
Example 19Treatment of Motor Neuron Disease with the HIRMAb-GDNF Fusion Protein
Motor neuron diseases such as amyotrophic lateral sclerosis (ALS) and spinal muscular atrophy (SMA) cause progressive paralysis leading to premature death. GDNF is highly neuroprotective of spinal cord motor neurons (Bohn supra). However, it is unlikely that GDNF will be developed as a drug for ALS or SMA, given the failed clinical trials of other neurotrophic factors for these conditions. Both BDNF and ciliary neurotrophic factor (CNTF) were administered to ALS patients in the 1990s by subcutaneous administration. The subcutaneous administration phase III clinical trials failed, because BDNF and CNTF, like GDNF, do not cross the BBB. However, with the re-engineering of GDNF as the HIRMAb-GDNF fusion protein demonstrated herein, conditions such as ALS or SMA could now be amenable to treatment by systemic administration. The HIRMAb fusion proteins cross the blood-spinal cord barrier, which as been demonstrated by brain scanning of adult Rhesus monkeys following intravenous administration of the HIRMAb fusion protein (Boado et al, Biotechnol. Bioeng, 97(6):1376-1386 (2007); Boado et al, Bioconjug. Chem. 18:447-455 (2007)).
Example 20Treatment of Brain or Spinal Cord Injury with the HIRMAb-GDNF Fusion Protein
GDNF promotes neural repair in the period following acute experimental brain injury, such as with a lateral fluid percussion injury (Bakshi et al, Eur. J. Neurosci. 23:2119-2134 (2006)). GDNF does not cross the BBB, and the BBB is intact in the days/weeks after head injury, when the brain attempts to heal from the acute insult. Therefore, the beneficial effects of GDNF on acute head injury could only be demonstrated by the intra-cerebral injection of genetically modified stem cells that secrete GDNF. Although the trans-cranial injection approach may be feasible in the rat brain, the human brain is 1000-fold larger than a rat brain. Diffusion of the GDNF from the depot injection site becomes limiting, and the GDNF cannot penetrate to the wound area, beyond the local injection site. Alternatively, if the GDNF is delivered to brain via the trans-vascular route, then every injured neuron in the brain is exposed to the GDNF. The latter is feasible with the weekly, bi-weekly, or daily systemic administration of the HIRMAb-GDNF fusion protein during the post-injury repair and rehabilitation period.
Similarly, motor neurons of the spinal cord are responsive to GDNF, and GDNF can promote neural repair following experimental spinal cord injury (Lu et al, J. Neurotrauma 19:1081-1090 (2002)). However, because the opening of the BBB following spinal cord injury is only transient, it is not possible to treat spinal cord injury with systemic GDNF administration. Instead, the GDNF expressing plasmid DNA was injected directly into the rat spinal cord following the acute spinal cord injury. However, the size of the spinal cord in humans is 1000-fold larger than that of the rat. Therefore, it is not possible to distribute GDNF to the entire lesioned area following direct spinal injection of the GDNF therapeutic in humans Alternatively, GDNF is delivered to all injured neurons in the spinal cord following a trans-vascular delivery, and this is possible with the systemic administration of the HIRMAb-GDNF fusion protein.
Example 21Treatment of Drug and Alchohol Addiction with the HIRMAb-GDNF Fusion Protein
The intra-cerebral injection of GDNF results in treatment of animals addicted to either opioid, or non-opioid drugs. With respect to non-opioid drugs, the intra-cerebral injection of GDNF decreases cocaine self-administration in rats (Green-Sadan et al, Eur. J. Neurosci., 18: 2093-2098, 2003). Similarly, the intra-cerebral injection of GDNF decreases ethanol self-administration (He et al, J. Neurosci., 25: 619-628, 2005). The GDNF has to be administered via a trans-cranial route, because GDNF does not cross the BBB. The drug, ibogaine, decreases withdrawal symptoms to chronic opioid drugs, cocaine, or alchohol, and works by increasing GDNF in regions of the brain such as the ventral tegmental area (VTA) (He and Ron, FASEB J, 20: E1820-D1827, 2006). Although ibogaine is a small molecule that crosses the BBB, its application in the treatment of addiction is limited by severe side effects. GDNF is implicated in another study related to cocaine addiction. Cocaine increases tyrosine hydroxylase in the VTA, and this effect of cocaine is blocked by the intra-cerebral injection of GDNF (Messer et al, Neuron, 26: 247-257, 2000). With respect to methamphetamine addiction, a decrease in brain concentration of GDNF, such as occurs in GDNF knock-out heterozygote mice, results in increased methamphetamine self-administration (Yan et al, FASEB J, 21: 1994-2004, 2007). These forms of addiction could be treated by systemic administration of GDNF if this neurotrophin was re-formulated to cross the BBB, which is the case for the HIRMAb-GDNF fusion protein.
While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.
Claims
1.-28. (canceled)
29. A composition comprising alpha-L-iduronidase (IDUA) covalently linked to the amino terminus of an antigen binding fragment of an antibody or to an antibody fragment binding to a transferrin receptor that is capable of crossing the blood brain barrier (BBB), wherein the composition is capable of producing an average elevation of concentration in the brain of the IDUA of at least about 1 ng/gram brain following intravenous administration, and wherein the composition comprises a mineral acid salt or a salt of an organic acid.
Type: Application
Filed: Jul 11, 2022
Publication Date: Dec 1, 2022
Inventors: William M. PARDRIDGE (Pacific Palisades, CA), Ruben J. BOADO (Agoura Hills, CA)
Application Number: 17/811,847