Abstract: Isolated porcine hepatocytes, isolated populations of such hepatocytes and methods for using the hepatocytes to treat subjects with disorders characterized by insufficient liver function are described. The porcine hepatocytes can be either hepatocytes isolated from adult, immature, or embryonic swine. The porcine hepatocytes can be modified to be suitable for transplantation into a xenogeneic subject, for example, by altering an antigen (e.g., an MHC class I antigen) on the cell surface which is capable of stimulating an immune response against the cell in the subject (e.g., by contact with an anti-MHC class I antibody, or a fragment or derivative thereof). The isolated porcine hepatocytes of the invention can be used to treat disorders characterized by insufficient liver function by administering the hepatocytes to a subject having such a disorder.

Abstract: The present invention provides new site-specific HSV-thymidine kinase mutants with improved nucleoside analog metabolizing activity due to low or no thymidine phosphorylation ability. Also provided is a method of killing target cells using such mutants combined with a prodrug.

Abstract: The use of recombinant adeno-associated virus (AAV) virions for delivery of DNA molecules to muscle cells and tissue is disclosed. The invention allows for the direct, in vivo injection of recombinant AAV virions into muscle tissue, e.g., by intramuscular injection, as well as for the in vitro transduction of muscle cells which can subsequently be introduced into a subject for treatment. The invention provides for sustained, high-level expression of the delivered gene and for in vivo secretion of the therapeutic protein from transduced muscle cells such that systemic delivery is achieved.

Abstract: The present invention relates to a ready-to-use ristocetin cofactor test reagent possessing long-term stability for use in coagulation tests.

Abstract: An enzymatic method is provided for treating ophthalmic disorders of the mammalian eye. Prevention of neovascularization and the increased rate of clearance from the vitreous of materials toxic to the retina is accomplished by administering an amount of hyaluronidase effective to liquefy the vitreous humor of the treated eye without causing toxic damage to the eye. Liquefaction of the vitreous humor increases the rate of liquid exchange from the vitreal chamber. This increase in exchange removes those materials and conditions whose presence causes ophthalmological and retinal damage.

Abstract: The present invention encompasses monoclonal and chimeric antibodies that bind to lipoteichoic acid of Gram positive bacteria. The antibodies also bind to whole bacteria and enhance phagocytosis and killing of the bacteria in vitro and enhance protection from lethal infection in vivo. The mouse monoclonal antibody has been humanized and the resulting chimeric antibody provides a previously unknown means to diagnose, prevent and/or treat infections caused by gram positive bacteria bearing lipoteichoic acid. This invention also encompasses a peptide mimic of the lipoteichoic acid epitope binding site defined by the monoclonal antibody. This epitope or epitope peptide mimic identifies other antibodies that may bind to the lipoteichoic acid epitope. Moreover, the epitope or epitope peptide mimic provides a valuable substrate for the generation of vaccines or other therapeutics.

Abstract: This invention provides a method of inhibiting an autoimmune response in an animal suffering from an autoimmune disease selected from the group consisting of psoriasis, Lyme disease and hyper IgE syndrome which comprises administering to the animal, in an amount effective to treat the autoimmune disease, an antibody that binds specifically to a protein specifically recognized by monoclonal antibody 5c8 produced by the hybridoma having ATCC Accession No. HB 10916.

Abstract: HCMV glycoproteins B and H have been identified. The gB protein is encoded by DNA in the HindIII F fragment of the HCMV genome lying between 1378 and 4095 bases from the F/D boundary. The gH protein is encoded by DNA in the HindIII L fragment lying between 228 and 2456 bases from the L/D boundary. The genes have been incorporated in recombinant vaccinia vectors and expressed in host animals to raise HCMV-neutralizing antibody, thereby indicating vaccine potential. The glycoproteins can also be used in a variety of different ways, as vaccines or in the production, purification or detection of HCMV antibody.

Abstract: The present invention provides methods of enhancing cognitive function in mammals by administering intracerebrally a homo-multimeric immunoadhesin molecule that contains the extracellular domain of AL-1, also known as ephrin-A5.

Abstract: Disclosed are compositions for treating allergies that include either BSW17 mimotope peptides or antibodies raised against BSW17 mimotope peptides. Also disclosed are methods for the treatment of allergies which involve administration of BSW17 mimotope peptides or the administration of antibodies raised against BSW17 mimotope peptides.

Abstract: The methods of the invention can be used to treat mycobacterial infections, or any disease or disorder that is caused by (or aggravated by) an intracellular pathogen. Accordingly, the invention features methods for treating a subject who has a disorder that is associated with an intracellular pathogen by administering, to a subject, a molecular conjugate that includes a photosensitizer (a term used herein to refer to a light activatable compound) and a targeting moiety, the targeting moiety being capable of targeting the conjugate to the intracellular pathogen.

Abstract: The present invention relates to glycosyl-etoposide prodrugs, a process for the preparation thereof and the use thereof in combination with functionalized tumor-specific enzyme conjugates for treating cancers.

Abstract: The present invention relates to detoxified immunogenic derivatives of Clostridium perfringens &bgr;-toxin or an immunogenic fragment thereof that have as a characteristic that they carry a mutation in the &bgr;-toxin amino acid sequence, not found in the wild-type &bgr;-toxin amino acid sequence. The invention also relates to genes encoding such &bgr;-toxins, as well as to expression systems expressing such &bgr;-toxins. Moreover, the invention relates to bacterial expression systems expressing a native &bgr;-toxin. Finally, the invention relates to vaccines based upon detoxified immunogenic derivatives of Clostridium perfringens &bgr;-toxin, and methods for the preparation of such vaccines.

Abstract: The present invention relates to immunologically active proteins from Borrelia burgdorferi which are present in a form which is free of other proteins derived from Borrelia burgdorferi and which exhibit the sequence of the protein 1829-22A, which has the amino acid sequence MKKFNLIIEALFAILLTACNFGLMEETKIALESSSKDVKNKILQIKKDAEDKGVNFAAFTSSETG SKVTNGGLALREAKIQAINEVEKFLKRIEEEALKLKEHGNSGQFLELFDLLLEVLESLEPIGIKG LKDFISEEAKCNPISTSERLIEVKVQIENKMEEVKRKQNLNKERKSNKGKKKK SEQ. ID NO.: 1 or a part sequence thereof having at least 10 consecutive amino acids, or exhibit the sequence of the protein 1829-22B, which has the amino acid sequence MIKYNKIILTLTLLASLLAACSLTGKARLESSVKDITNEIEKAIKEAEDAGVKTDAFTETQTGGK VAGPKIRAAKIRVADLTIKFLEATEEETITFKENGAGEDEFSGIYDLILNAAKAVEKIGMKDMTK TVEEAAKENPKTTANGIIEIVKVMKAKVENIKEKQTKNQK SEQ. ID NO.: 2 or a part sequence thereof having at least 10 consecutive amino acids.

Abstract: Compositions of pro-IFG-I E-peptides for the treatment and amelioration of tumor-producing diseases, and methods for their utilization.

Abstract: This invention relates to a DNA coding for a peptide of a papilloma virus major capsid protein and a papilloma virus genome, respectively. In addition, this invention concerns proteins coded by the papilloma virus genome and antibodies directed against them as well as their use for diagnosis, treatment and vaccination.

Abstract: The incorporation of multiple branch peptide constructions having activity against HIV into liposomes of sufficient size for white blood cell internalization (e.g. greater than 150 nm and preferably approximately 250-400 nm. ) has been shown to increase the activity of those MBPCs manifold. The liposomes and pharmaceutical compositions are described herein.

Abstract: This invention relates to the use of specifically attenuated live BVD (bovine viral diarrhea) viruses for the preparation of a vaccine for use in the prevention and/or treatment of BVDV infections in breeding stocks of cattle, pregnant cows and for fetal protection in pregnant cows.

Abstract: Nucleic acid and amino acid sequences of the Omp85 proteins of N. gonorrhoeae and N. meningitidis, and fragments thereof are useful in vaccine compositions, therapeutic compositions and diagnostic compositions for use in the prevention, treatment and diagnosis of non-symptomatic gonococcal infection or symptomatic disease and non-symptomatic meningococcal infection and symptomatic disease. Antibodies are developed to these proteins and also useful in the compositions and methods described herein.

Abstract: Bovine respiratory disease (BRD) complex, shipping fever, or pneumomic pasteurellosis, is a multifactorial disease whereby a combination of viral infection, adverse environment and poor immune status may combine to predispose animals to bacterial infections. The exotoxin, or leukotoxin (Lkt), may contribute to pathogenesis by impairing the primary lung defenses and subsequent immune responses or by causing inflammations as a result of leukocyte lysis. The present invention provides a modified microorganism which produces an Lkt toxin, wherein said Lkt toxin is partially or fully inactivated. In a further embodiment of the present invention, there is provided a modified microorganism wherein an Lkt toxin operon including an Lkt structural gene and/or a post transational activator of the organism is partially or fully inactivated. The present applicants have found that a precursor of Lkt toxin has reduced toxic activity.

Abstract: The invention concerns an oil-in-water immunostimulant emulsion comprising an aqueous phase and an oil phase, characterised in that it further comprises an immunostimulant polynucleotide whereof at least part is covalently bound to at least a lipid molecule. The invention also concerns a vaccine composition comprising such an emulsion as immunoadjuvant.

Abstract: A therapeutic composition comprising (i) at least one antigen or at least one in vivo generator of a compound comprising an amino acid sequence and (ii) at least one adjuvant comprising at least one pharmaceutically acceptable and water-soluble salt of an organic anion and a metal cation.

Abstract: Mucosal adjuvants for vaccines contain water-soluble polyanionic polymers which have anionic constitutional units obtained from acids such as acrylic acid, methacrylic acid, maleic acid, fumaric acid, ethylsulphonic acid, vinylsulphuric acid, vinylsulphonic acid, styrenesulphonic acid, vinylphenylsulphuric acid, 2-methacryloyloxyethane sulphonic acid, 3-methacryloyloxy-2-hydroxypropanesulphonic acid, 3-methacryl amido-3-methylbutanoic acid, acrylamidomethylpropanesulphonic acid, vinylphosphoric acid, 4-vinylbenzoic acid, 3-vinyl oxypropane-1-sulphonic acid, N-vinylsuccinimidic acid, and salts of the foregoing. The polyanionic polymers may further have hydrophobic constitutional repeating units, such as alkylesters, cycloalkylesters, hydroxyalkylesters, ethers, glycols, aromatic groups and salts thereof. The adjuvants containing the polyanionic polymers are used in vaccines for the induction or enhancement of mucosal immune responses.

Abstract: A packaged effervescent product is provided which includes a sachet surrounded by an outer package film sealing the sachet against water vapor transmission. The sachet is a cosmetic article which includes an effervescent cleansing composition of an acid material such as citric add and an alkaline material such as sodium bicarbonate. The composition is held within the sealed sachet or pouch. At least one wall of the pouch is water permeable. The outer package film is formed of a material which must have a breathability for carbon dioxide. Any carbon dioxide generated during storage is thereby allowed to slowly diffuse into the atmosphere while still minimizing the amount of water which may enter the package.

Abstract: A wiping article is provided which includes an effervescent cleanser composition held within a pouch formed from a first and second substrate sheet. At least one of the substrate sheets must be water permeable. The effervescent composition is an intimate mixture of an acid material such as citric acid and an alkaline material such as sodium bicarbonate. Water contact causes the combination to effervesce. A dry surfactant such as sodium cocoyl isethionate in contact with the water and effervescing carbon dioxide results in a highly pleasant sudsing system. Skin benefit agents may be included within the composition. The effervescent action may improve deposition of the skin benefit agents onto the skin.

Abstract: The present invention discloses improved lysophospholipids composition having water-solubility in order to solve a conventional problem accompanying only the use of LPE as an anti-aging lysophospholipid caused by water-insoluble property thereof, comprising subsidiary lysophospholipid components, that is, LPI and LPC other than LPE to inhibit aging processional lysophospholipids, thereby forming an enhanced water-soluble lysophospholipids composition conveniently useable in plants and/or animals applications.

Abstract: Antimicrobial formulations, which may be essentially free of an antimicrobial active, comprising one or more proton donating agents and an alkyl phosphate anionic surfactant comprising a mono alkyl phosphate having the chemical structure: wherein R1 is a saturated or unsaturated straight chain or branched alkyl group having from about 8 to about 22 carbon atoms, x is a number from 0 to about 20, and R2 and R3 are independently selected from hydrogen, an alkali metal, or an alkanol amine, are provided and described herein. The formulations may be incorporated into wet wipes or various other personal care items such as facial tissue, bathroom tissue or feminine care products, or may be incorporated into lotions or soaps which may be applied directly to the skin. The antimicrobial formulations of the present invention have been found to have surprisingly high activity against numerous bacteria and other microorganisms.

Abstract: Disclosed is a composition including a lower alcohol and water in a weight ratio of about 35:65 to 100:0, between at least 0.5% and 8.0% by weight thickener system comprised of at least two emulsifiers, each emulsifier present in at least 0.05% by weight wherein the composition free of auxiliary thickeners has a viscosity of at least 4,000 centipoise at 23° C. and wherein each emulsifier is comprised of at least one hydrophobic group and at least one hydrophilic group. The composition is useful as a presurgical scrub replacement, a lotion or other hand preparation.

Abstract: A detergent such as nonionic, cationic or anionic detergents and preferably a “sugar detergent” such as octyl-glucopyranoside is rendered insoluble by being bound to an inert substrate. This detergent is effective at inactivating pathogens even when so bound. Under these conditions the concentration of detergent free in solution is vanishingly low: probably below one millimolar in concentration. Addition of insoluble detergent results in effective destruction of enveloped viruses in a variety of protein containing solutions such as blood, plasma, clotting factors or other proteins purified from human blood. Because the detergent is essentially entirely bound to the solid substrate, there is little or no difficulty in ensuring that the end product is detergent-free. Because the detergent is so bound, it causes essentially no damage to proteins, blood cells and other cellular material.

Abstract: Paclitaxel is provided in a porous matrix form, which allows the drug to be formulated without Cremophor and administered as a bolus. The paclitaxel matrices preferably are made using a process that includes (i) dissolving paclitaxel in a volatile solvent to form a paclitaxel solution, (ii) combining at least one pore forming agent with the paclitaxel solution to form an emulsion, suspension, or second solution, and (iii) removing the volatile solvent and pore forming agent from the emulsion, suspension, or second solution to yield the porous matrix of paclitaxel. The pore forming agent can be either a volatile liquid that is immiscible with the paclitaxel solvent or a volatile solid compound, preferably a volatile salt. In a preferred embodiment, spray drying is used to remove the solvents and the pore forming agent.

Abstract: The invention relates to a sterile ophthalmic drop preparation, especially a gel preparation, which comprises a two-phase carrier liquid or gel basis comprising a liquid aqueous and a liquid hydrophobic phase.

Abstract: Immune response modifier compounds—imidazoquinoline amines, imidazopyridine amines, 6,7-fused cycloalkylimidazopyridine amines, and 1,2-bridged imidazoquinoline amines—are useful for the treatment of TH2 mediated diseases by administering a therapeutically effective amount of such compounds in order to inhibit TH2 immune response, suppress IL-4/IL-5 cytokine induction and eosinophilia, as well as enhance TH1 immune response.

Abstract: This invention relates to compositions containing polyphenols, for example, cocoa polyphenols such as procyanidins, in combination with at least one cholesterol lowering agent, and methods for improving vascular health including treating and preventing atherosclerosis and cardiovascular disease.

Abstract: This invention includes emulsion formulations comprising an aqueous carrier and the following components: triglyceride, cholesterol, phospholipid, at least one charged lipid, at least one hydrophilic biologically active molecule and, optionally, cholesteryl ester, and/or apoprotein; methods of preparing these emulsions; and the use of these emulsions for the delivery of hydrophilic biologically active molecules to cells.

Abstract: A liposome suspension forms spontaneously upon adding a diacylglycerol-PEG lipid to an aqueous solution when the lipid has appropriate packing parameters and the adding occurs above the melting temperature of the lipid. Combinations of lipids may be used in the invention. The liposome suspensions are useful for a variety of purposes, including delivery of theraputic agents.

Abstract: An enteric coated pharmaceutical dosage form comprising an H+,K+-ATPase inhibitor is disclosed. The dosage form comprises at least two portions of the H+,K+- ATPase inhibitor to be released in at least two consecutive pulses. The dosage form has at least one fraction with a pulsed delayed release and another fraction with instant release of the H+,K+-ATPase inhibitor. The portions are released in time by from 0.5 and up to 12 hours interval, preferably by from 0.5 and up to 8 hours, and more preferably by from 0.5 and up to 4 hours interval. The dosage form is intended for once daily administration.

Abstract: The present invention is directed to a method for treating the symptoms associated with fibromyalgia and related conditions by administering flupirtine.

Abstract: This pharmaceutical medicine comprises an iron salt, not less than two polyols, a binding agent, a lubricating agent, and a flavoring agent. The dose of elemental iron is not less than 5 mg, and preferably 10 mg to 15 mg per tablet. The proportion of one of the polyols on its own is not less than 10%, and preferably not less than 20% of the total mass of the tablet, the overall proportion of the polyols being not less than 50% and preferably not less than 75%. One of the two polyols is xylitol, comprising not less than 10%, and preferably not less than 20%. The other polyol is sorbitol and/or mannitol.

Abstract: A process for preparing divalproex sodium tablets is provided. The process comprises preparing a neutralized divalproex sodium solution by combining divalproex sodium, having a sodium valproate and a valproic acid moiety, with an aqueous solvent and a base, e.g., sodium hydroxide, the base being in sufficient amount to ensure neutralization of the valproic acid moiety of the divalproex sodium. The neutralized divalproex sodium solution is sprayed onto a pharmaceutically acceptable carrier, and processed to obtain divalproex sodium tablets.

Abstract: The present invention relates to a pharmaceutical preparation for oral administration which comprises moxifloxacin, its salt and/or hydrate and lactose, to a process for its preparation, and to the use of this preparation for controlling bacterial infections in humans and animals.

Abstract: An antibiotic product for delivering at least Amoxicillin or Clarithromycin that is comprised of three dosage forms with different release profiles with each of Amoxicillin and Clarithromycin being present in at least one of the dosage forms.

Abstract: The present invention relates to compositions and methods for orally delivering antigens. The antigen and an adjuvant are combined with an acylated amino acid or polyamino acid and, a sulfonated amino acids or polyamino acid, or a salt of the foregoing.

Abstract: The invention relates to an anti-diabetic agent obtained from the plant Humboldtia decurrens, an anti-diabetic formulation comprising an effect amount of the extract obtained from the plant Humboldtia decurrens optionally together with additives, a process for obtaining the anti-diabetic agent, and a method for treatment of diabetes.

Abstract: A method and kit for enhancing the natural fertility process. The kit includes a vaginal douche that is used prior to intercourse to enhance the sperm transportation and sustaining properties of the cervical mucous. The douche contains a balanced electrolyte solution, polysaccharides, and pH buffers. The kit also includes nutriceuticals specifically formulated for both the male and female which include amino acids, minerals, vitamins, herbs, phytoestrogens, and antioxidants along with a specified dosing regimen. A basal body temperature thermometer and chart is provided with instructions to confirm when and if ovulation will/did occur. Commercially available urinary chemical reagent strips are provided with instructions so as to predict/confirm if and when ovulation will occur. A lubricating medium will also be provided and utilized at the time of intercourse which is nonspermicidal and which contains polysaccharides which influence natural sperm motility.

Abstract: This invention relates to method of treating visceral leishmaniasis or kala-azar by administering effective amount of betel leaf extract or lyophilized extract together with or associated with an additive and a composition comprising betel leaf extract with a pharmaceutically acceptable additive.

Abstract: A feed supplement for arthropods, in particular for lepidopteran larvae, comprising a low alkyl ester of a biologically active acid or alpha-amino acid. Said alkyl esters of a biologically active acid or alpha-amino acid have general formula (I), in which: X is hydrogen or NH2; R1 is a straight or branched alkyl or alkenyl group, containing 3 to 6 carbon atoms, optionally substituted with at least one hydroxy, carboxylic, amino, amido, guanidyl, thio, methylthio, phenyl or imidazolyl group; and R2 is a group selected from methyl, ethyl and propyl.

Abstract: Methods of reducing cystine containing animal and plant proteins, and improving dough and baked goods' characteristics is provided which includes the steps of mixing dough ingredients with a thiol redox protein to form a dough and baking the dough to form a baked good. The method of the present invention preferably uses reduced thioredoxin with wheat flour which imparts a stronger dough and higher loaf volumes. Methods for reducing snake, bee and scorpion toxin proteins with a thiol redox (SH) agent and thereby inactivating the protein or detoxifying the protein in an individual are also provided. Protease inhibitors, including the, Kunitz and Bowman-Birk trypsin inhibitors of soybean, were also reduced by the NADP/thioredoxin system (NADPH, thioredoxin, and NADP-thioredoxin reductase) from either E. coli or wheat germ. When reduced by thioredoxin, the Kunitz and Bowman-Birk soybean trypsin inhibitors lose their ability to inhibit trypsin.

Abstract: A coated corn grit product is provided that has individual pieces of corn grit having a fat-free coating. A coated corn grit product is also provided that has clusters of corn grit pieces having a fat free coating. The fat free coating is made from at least one material selected from colorants, flavors, nutrients, and sweeteners.

Abstract: A process for making confection compositions such as ice pops of gel consistency, in the absence of heat treatment which takes advantage of a chemical reaction between an alginate salt, other than calcium alginate, or a low methoxy pectin and free calcium provides a homogeneous gel product which can be subsequently depositing into a mold pocket and converted into a desired product such as an ice pop by traditional steps.

Abstract: Drops of Honey is a capsule made of hydroxymethlcellulose that is filled with honey. Drops of Honey is a food product in which its capsule dissolves in boiling water. This allows for the honey to escape into the beverage of choice, preferably tea. It is a food product that will be mainly used with tea and other hot beverages.