Abstract: Acicular mullite bodies are made in two-step firing process in which a green body is converted first to a fluorotopaz and then to acicular mullite. The bodies are contained within an enclosed region of the furnace. A flow of process gas is provided through the enclosed region during the fluorotopaz-forming step. The process gas is introduced into the enclosed region through multiple openings on at least one side of the enclosed region, and withdrawn through multiple openings on another side of the enclosed region. During the acicular mullite-forming step, a flow of purge gas is maintained in the exterior portion of the furnace. This purge gas may be removed by flowing it into the enclosed region of the furnace and out of the furnace from the enclosed region without re-entering the exterior portion for the furnace.

Abstract: To produce scaly silica particles in which formation of irregular particles is prevented. A process for producing scaly silica particles, which comprises a step of subjecting a silica powder containing silica agglomerates having scaly silica particles agglomerated, to acid treatment at a pH of at most 2, a step of subjecting the silica powder subjected to the acid treatment, to alkali treatment at a pH of at least 8 to deflocculate the silica agglomerates, and a step of wet disintegrating the silica powder subjected to the alkali treatment to obtain scaly silica particles.

Abstract: A porous silica having a low refractive index and being stable when exposed to water, and which is configured to have a refractive index of 1.3 or lower and to have a difference of the refractive index at a wavelength 550 nm between before the immersion into water and after the immersion into water for 24 hours of 0.15 or lower.

Abstract: A method of fabricating silicon carbide powder according to the embodiment comprises the steps of preparing a mixture by mixing a silicon source comprising silicon with a carbon source comprising a solid carbon source or an organic carbon compound; reacting the mixture; and controlling the reacting of the mixture, wherein the step of controlling the reacting comprises a step of supplying process gas or reaction product gas.

Abstract: Embodiments provide a gas distribution arrangement, a device for handling a chemical reaction comprising such a gas distribution arrangement and a method of providing a chemical reaction chamber with a gas. The distribution arrangement comprises a distribution plate for separating a chemical reaction chamber from a gas inlet area and having a first side arranged to face the chemical reaction chamber and a second side arranged to face the gas inlet area and comprising a set of through holes stretching between the first and the second side, where the first side of the plate comprises a first material surrounding the holes and having a first thermal conductivity, and the plate also comprises a second material forming a base structure also surrounding the holes and having a second thermal conductivity.

Abstract: A method for preparing a suspension of LDH particles comprises the steps of preparing LDH precipitates by coprecipitation to form a mixture of LDH precipitates and solution; separating the LDH precipitates from the solution; washing the LDH precipitates to remove residual ions; mixing the LDH precipitates with water; and subjecting the mixture of LDH particles and water from step (d) to a hydrothermal treatment step by heating to a temperature of from greater than 80° C. to 150° C. for a period of about 1 hour to about 48 hours to form a well dispersed suspension of LDH particles in water.

Abstract: A process for producing NO gas from a feed flow of air or oxygen enriched air, by means of moving an electric arc through the air flow by using a magnetic field and AC or DC currents, in a reactor, wherein a pressure lower than 1 bar is applied, wherein the temperature in the exited arc is adjusted to be within the range of 3000 to 5000 Kelvin, and wherein the air flow is quenched by applying a spray of fine water droplets upstream or just downstream the arc, excess air feed or bypassed air to obtain a stable NO-containing plasma having a temperature below 2000 Kelvin.

Abstract: The present invention provides a carbon dioxide absorber capable of efficiently and stably removing carbon dioxide in a gas or solution. This carbon dioxide absorber contains an amine compound, a weakly acidic compound and water, the pKb value of the amine compound in an aqueous solution at 30° C. is 4.0 to 7.0, the pKa value of the weakly acidic compound in an aqueous solution at 30° C. is 7.0 to 10.0, and the weakly acidic compound is present in an amount within the range of 0.01 equivalents to 1.50 equivalents with respect to amino groups of the amine compound.

Abstract: The present invention provides a prophylactic or therapeutic agent for fracture and bone diseases as well as a bone growth promoting agent containing carbon dioxide as an active ingredient. Further, according to the present invention, an additive or synergistic effect for preventing or treating fracture and bone diseases as well as for promoting bone growth by combining the therapeutic agent of the present invention and a bone absorption inhibitor and/or a bone formation promoter is obtained.

Abstract: The invention relates to a process for parallel preparation of hydrogen and one or more carbonaceous products, in which hydrocarbons are introduced into a reaction space (R) and decomposed thermally to carbon and hydrogen in the presence of carbon-rich pellets (W). It is a feature of the invention that at least a portion of the thermal energy required for the hydrocarbon decomposition is introduced into the reaction space (R) by means of a gaseous heat carrier.

Abstract: The invention is directed to carbon nanotube-containing compositions that have increased viscosity and stability. In particular, the invention is directed to methods for manufacturing carbon nanotube films and layers that provide superior electrical properties.

Abstract: Disclosed are an apparatus and method for continuously producing carbon nanotubes. More specifically, disclosed are an apparatus for continuously producing carbon nanotubes including i) a reactor to synthesize carbon nanotubes, ii) a separator to separate a mixed gas from the carbon nanotubes transferred from the reactor, iii) a filter to remove all or part of one or more component gases from the separated mixed gas, and iv) a recirculation pipe to recirculate the filtered mixed gas to the reactor for carbon nanotubes. Advantageously, the apparatus and method for continuously producing carbon nanotubes enable rapid processing, exhibit superior productivity and excellent conversion rate of a carbon source, significantly reduce production costs, reduce energy consumption due to decrease in reactor size relative to capacity, and generate little or no waste gas and are thus environmentally friendly.

Abstract: A graphitization furnace (100) includes: split electrodes (122) that are conductive and are provided so as to be freely movable; crucibles (120) that are conductive and that contain carbon powder, with a bottom end portion (122a) of each split electrode (122) being buried in the carbon powder; upper electrodes (190) that are positioned so as to face a split electrode (122); lower electrodes (192) that are positioned so as to face a crucible (120); and a power supply unit (132) that, when a bottom end portion (190a) of an upper electrode (190) is placed in contact with a top end portion (122b) of a split electrode (122) and a top end portion (192a) of a lower electrode (192) is placed in contact with a base portion (120b) of a crucible (120), applies a voltage between the upper electrode (190) and the lower electrode (192).

Abstract: The present invention relates to a method for preparing lithium manganese oxide used as a lithium adsorbent and, more particularly, to a method for preparing lithium manganese oxide by a solid-phase reaction. According to the preparation method of the present invention, since the entire reaction is carried out only by the solid-phase reaction, it is possible to solve the problem of waste fluids produced during a conventional liquid-phase reaction, and the preparation method of the present invention is a single process, which is suitable for mass production.

Abstract: The present invention relates to the discovery that mutations in KCNJ5 are associated with adrenal diseases and disorders. The invention includes compositions and methods for the assessment, characterization and treatment of adrenal diseases and disorders, based upon the presence or absence of a KCNJ5 mutation that is associated with an adrenal disease or disorder.

Abstract: Compositions and methods are provided for preventing or attenuating cancer progression or blocking metastasis in prostate cancer and other cancers (e.g., ovarian carcinoma, endometrial cancer, renal cell carcinoma) that are characterized by overexpression of the type II cell surface serine protease hepsin, based on the discovery of multiple disclosed compounds having activity as specific hepsin inhibitors.

Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.

Abstract: The present invention refers to novel dimeric proteins obtained from modified ubiquitin capable of binding targets with high affinity. The novel dimeric binding proteins comprise a combination of amino acid substitutions and at least one insertion of amino acids in one of the monomers. The invention is further directed to the use of said proteins in medical diagnosis or treatment methods.

Abstract: The present invention provides a process for [18F]-fluorination of biomolecules containing a primary amino group such as proteins and peptides and in particular of peptides. The invention further provides reagents for this process, in particular 18F-labelled prosthetic groups for use in the preparation as well as non-labelled intermediates useful in the preparation of the [18F]-labelled prosthetic groups. [18F]-labelled compounds useful as radiopharmaceuticals, specifically for use in Positron Emission Tomography (PET) are also provided.

Abstract: The invention provides monoclonal antibody 5C1 and related antibodies. The 5C1 antibody binds to an epitope within residues 118-126 of ?-synuclein. The antibodies of the invention are useful, for example, for treating and/or diagnosing disorders associated with ?-synuclein, particularly accumulation of ?-synuclein deposits. Such disorders include Lewy body diseases, such as Parkinson's disease, Diffuse Lewy Body Disease (DLBD), Lewy body variant of Alzheimer's disease (LBV), Combined Alzheimer's and Parkinson disease, pure autonomic failure and multiple system atrophy (MSA).

Abstract: Provided is a polymeric micelle pharmaceutical preparation that can increase the ratio of contrast at tumor site to background contrast in a short period of time after administration of a lactosome and can suppress the ABC phenomenon so that the lactosome can be administered more than once within a short span. A branched-type amphiphilic block polymer comprising: a multi-branched hydrophilic block comprising sarcosine; and a hydrophobic block comprising polylactic acid. The branched-type amphiphilic block polymer, wherein the number of branches of the hydrophilic block is 3. A molecular assembly comprising the branched-type amphiphilic block polymer. The molecular assembly further comprising a linear type amphiphilic block polymer.

Abstract: A method for evaluating the efficacy of a candidate drug for the treatment of a bipolar disorder is provided. The method includes administering the candidate drug or combination of drugs to a mouse characterized by an elevated amount of Otx2 protein in the hindbrain; and evaluating the extent, frequency and/or reversal of a mouse behaviour that is homologous to a bipolar disorder in a human.

Abstract: Embodiments provided herein relate to methods and compositions for treating or preventing cancer. More particularly, several embodiments are drawn to treating or preventing malignant mesothelioma with antagonists of HMGB1.

Abstract: Disclosed are lipidomimetic compounds of formula I (I) wherein: G represents a group satisfying formula II: HO—CH2—{CH(OH)—CH2-0}m-CH2—{C(=0)-0-CH2})q— formula II each n independently is an integer from 1-30; m is an integer from 1-10; q is 0 or 1. These compounds can be added to the lipid bilayer of thermosensitive liposomes, for the purpose of aiding in the prevention of leakage of the liposomes' contents at 37° C., and retarding clearance from circulation.

Abstract: The present invention provides liposome compositions containing substituted ammonium and/or polyanion, and optionally with a desired therapeutic or imaging entity. The present invention also provide methods of making the liposome compositions provided by the present invention. The present invention also provides for the methods and kits for the delivery of liposomal compositions to the brain.

Abstract: Small Molecule Metabolite Reporters (SMMRs) for use as in vivo glucose biosensors, sensor compositions, and methods of use, are described. The SMMRs include boronic acid-containing xanthene, coumarin, carbostyril and phenalene-based small molecules which are used for monitoring glucose in vivo, advantageously on the skin.

Abstract: Composition and method for surface-functionalized SPION-based agents. Such agents can provide highly pH-sensitive MRI contrast in tissue.

Abstract: The application relates to a compound of general formula (I) below: Signal-Linker-Peptide??(I) and to the uses thereof for medical imaging or diagnosis or the preparation of a composition for diagnosis of an MUC5AC pathological condition.

Abstract: The present disclosure relates to cosmetic compositions comprising an organosilane (A) having the formula: (R1)n(R2O)(3?n)SiR3O(CH2CH2O)a(C3H6O)bR4 where n is 1, 2, or 3, a?1, b may vary from 0 to 30, with the proviso a?b, R1 is a hydrocarbon group containing 1 to 12 carbon atoms, R2 is hydrogen or an alkyl group containing 1 to 6 carbon atoms, R3 is a divalent hydrocarbon group containing 2 to 12 carbon atoms, R4 is hydrogen, R1, or an acetyl group; and a cosmetic ingredient (B), and optionally in a cosmetically acceptable medium.

Abstract: Disclosed are pressurized surface treatment compositions which impart a microbicidal benefit to treated surfaces which compositions comprise (or in certain preferred embodiments may consist essentially of, or may consist of): a copper source material which releases copper ions into the treatment composition, preferably a source of Cu(I) and/or Cu(II) ions, at least lower alkyl aliphatic monohydric alcohol which independently of other constituents present exhibits a microbicidal effect, a propellant; and, water. The compositions may further optionally include one or more further optional constituents such as a detersive surfactant and/or minor amounts of one or more constituents which impart one or more advantageous technical or aesthetic benefits to the compositions, including one or more detersive surfactants wherein the compositions have pH of at least 5. The compositions exhibit a microbicidal or germicidal or antimicrobial effect on treated inanimate surfaces or when used to treat an airspace, e.g.

Abstract: Provided is a toothpaste composition for dentin hypersensitivity that effectively prevents pain attributed to dentin hypersensitivity, instantaneously and sufficiently seals the openings of dentinal tubules in an exposed dentinal surface, and has excellent sustainability of the effect of suppressing the pain attributed to dentin hypersensitivity.

Abstract: It has been found that toothpastes containing balance amounts of calcium based abrasive, copolymer of vinylmethylether and maleic acid and clay have significantly better stability even at elevated temperature. It has also been determined that the selected combination allows for complete removal of or at least a significant reduction in thickening silica, with almost no adverse effect on rheology. Disclosed is a toothpaste composition comprising: (i) a calcium based abrasive; (ii) a copolymer of vinylmethyl ether and maleic acid; and (iii) a clay, wherein ratio of the calcium based abrasive to said copolymer of vinylmethyl ether and maleic acid is at least 1:0075 and ratio of said calcium based abrasive to said clay is at least 1:0.02.

Abstract: A compound of formula (I) is used to modify the taste or flavour of a flavour composition or consumable product, wherein R1 is H, or a substituted, unsubstituted, branched or unbranched C1-C5 alkyl group and, NHR2 is a residue of an amino acid, is selected from Alanine (Ala), cysteine (Cys), Aspartic acid (Asp), phenylalanine (Phe), glutamic acid (Glu), histidine (His), isoleucine (Ile), lysine (Lys), leucine (Leu), methionine (Met), asparagines (Asn), glutamine (Gln), arginine (Arg), serine (Ser), theronine (Thr), valine (Val), tryptophan (Trp), tyrosine(Tyr) and Glycine (Gly), with the proviso that the compound is not N-acetyl glycine. Also disclosed are flavour compositions and consumable products containing such compounds.

Abstract: Process for heat treating precipitated silica to improve stability. Oral care compositions comprising such heat treated precipitated silica abrasives and a stannous ion source.

Abstract: Linoleic or Linolenic acid esters of resveratrol and topical compositions containing the esters.

Abstract: The invention relates to water-soluble or water-swellable polymers the repeating structural units of which consist of a) 90.0 to 99.99 mole-% of one or more repeating structural units originating from special monomers with sulfonic acid groups or the salts thereof such as for example 2-acrylamido-2-methyl-propanesulfonic acid or the salts thereof and b) 0.01 to 10.0 mole-% of one or more repeating structural units originating from special cross-linking agents with at least three polymerizable double bonds. The polymers for example have an advantageous sensory property profile and are highly suitable as thickening agents even in salt-containing compositions. They are furthermore advantageously suitable for producing cosmetic, dermatological or pharmaceutical compositions.

Abstract: The invention relates to a fluid composition containing at least a polymer, a plasticiser, a volatile solvent, and a very small amount of an organic sun filter in the order of between 0.5 and 2.2 wt.-% in relation to the total weight of the composition. The composition, which is intended to be applied to the skin, can be used to treat scars. In addition, the composition advantageously contains a derivative of dibenzoylmethane and a cinnamate derivative.

Abstract: This invention relates to a cationically and amphiphilically modified polygalactomannan having repeating units with an average D-mannosyl to D-galactosyl residue ratio of at least 5 to 1 and to compositions containing same. A portion of the hydrogen atoms of hydroxyl groups situated on the mannosyl and galactosyl residues of the galactomannan are replaced with an amphiphilic and a cationic substituent.

Abstract: An inverse latex including from 20% to 70% by weight and preferably from 25% to 50% by weight of a branched or crosslinked polyelectrolyte, characterized in that the polyelectrolyte is a copolymer of 2-acrylamido-2-methylpropanesulfonic acid partially or totally salified with acrylamide and optionally one or more monomers chosen from monomers containing a partially or totally salified weak acid function and/or from neutral monomers other than acrylamide, the production process including the control of the pH in the initial aqueous phase; Cosmetic, dermopharmaceutical or pharmaceutical composition including the inverse latex directly obtained by the process.

Abstract: A method of producing an anhydrous antiperspirant composition comprising (a) providing a mixture of at least one antiperspirant active including a metal salt, and an anhydrous carrier for the at least one antiperspirant active in which the at least one antiperspirant active is dissolved, the carrier comprising a eutectic mixture of at least one basic compound selected from a basic amide and a basic amine and at least one member chosen from a cation and zwitterion; and (b) heating the mixture to form a stabilized eutectic system of the at least one antiperspirant active and the anhydrous carrier, and wherein the at least one antiperspirant active, the at least one basic compound and the at least one member chosen from a cation and zwitterion form a ternary eutectic system.

Abstract: This invention relates to the use of an oral composition comprising Stevia extract, steviol precursors, or steviol which enhances the appearance of hair. It further relates methods of improving the appearance of hair by oral administration of an effective amount of Stevia extract, steviol precursors or steviol.

Abstract: An aqueous emulsion comprising at least a covalently bound vinyl oligomer and vinyl polymer, wherein said vinyl oligomer comprises 5 to 85 mol % of vinyl monomers bearing quaternary ammonium ion functional groups or quaternisable amine functional groups and is obtained by a controlled radical polymerisation of at least one vinyl monomer via a reversible addition-fragmentation chain transfer mechanism in solution in the presence of a control agent and a source of free radicals; wherein said vinyl polymer is obtained by emulsion polymerisation of vinyl monomers in the presence of the vinyl oligomer; wherein the weight % ratio of vinyl oligomer to vinyl polymer is in the range of from 0.5:99.5 to 65:35.

Abstract: The present invention relates to pregnancy hormone combinations and methods of treatment for autoimmune diseases having at least two hormonal components, a pregnancy hormone (such as estriol), and a gestagen (such as levonorgestrel or norethindrone) thereby providing for the continuous, uninterrupted administration of pregnancy hormones for the treatment for autoimmune disorders, such as multiple sclerosis.

Abstract: The invention provides small molecule mimics of the Smac peptide that are dimer-like or trimer-like compounds having two or three amide-containing domains connected by a linker. These compounds are useful to promote apoptosis. The invention includes pharmaceutical compositions comprising such compounds and methods to use them to treat conditions including cancer and autoimmune disorders.

Abstract: Hepatitis C virus inhibitors having the general formula (I) are disclosed. Compositions comprising the compounds and methods for using the compounds to inhibit HCV are also disclosed.

Abstract: Antiviral activity of Nilotinib against Hepatitis C virus.

Abstract: A method of treating hepatitis C virus infection, comprising administering to a subject in need thereof (a) an effective amount of at least one HCV inhibitor selected from the group consisting of an HCV NS3 inhibitor, an HCV NS5B inhibitor, ribavirin, and an IFN-?; and (b) an effective amount of an anti-HCV compound of formula (I).

Abstract: The present invention relates to the treatment of hepatitis C (HCV) infection by the combination treatment with a miR-122 inhibitor and a HCV NS3/4A protease inhibitor.

Abstract: The present invention relates to antiviral therapies and compositions for treating or preventing Hepatitis C infections in patients and relates to other methods disclosed herein. The invention also relates to kits and pharmaceutical packs comprising compositions and dosage forms. The invention also relates to processes for preparing these compositions, dosages, kits, and packs.

Abstract: The invention provides novel strains of Trichoderma spp. showing increased biocidal activity and the method for preparation thereof and use thereof as a biocide. The invention especially provides a new strain of Trichoderma atroviride having high antifungal activity, in particular to be used in agriculture as a bio-fungicide. The invention also includes a new antimicrobial composition containing the new Trichoderma strains, and a new composition enhancing plant growth containing the new strains.