Abstract: Antimicrobial and antithrombogenic polymer or polymeric blend, compounds, coatings, and materials containing the same, as well as articles made with, or coated with the same, and methods of making the same exhibiting improved antimicrobial properties and reduced platelet adhesion. Embodiments include polymers with antimicrobial and antithrombogenic groups bound to a single polymer backbone, an antimicrobial polymer blended with an antithrombogenic polymer, and medical devices coated with the antimicrobial and antithrombogenic polymer or polymeric blend.

Abstract: Preferred embodiments relate to compositions of inherently radiopaque, biocompatible, bioresorbable polymeric particles and methods of using them for embolizing a body lumen.

Abstract: The present invention generally relates to topical compositions and methods of using the same. The topical compositions may comprise a hydrophilic composition and a hydrophobic composition in admixture. The hydrophobic composition may include a nitric oxide-releasing compound such as, for example, a diazeniumdiolate functionalized co-condensed silica particle. In some embodiments, the topical composition may be self-emulsifying. Further described herein are kits comprising a hydrophilic composition and a hydrophobic composition.

Abstract: Methods are provided to make clinoptilolite into a water-soluble hydrolyzed form suitable for various administration routes, including oral administration. Absorption of water-soluble hydrolyzed clinoptilolite fragments can aid in detoxification by binding heavy metals and environmental toxins, can reduce reactive oxygen species and inflammation related to heavy metals and other/environmental toxins, resulting in an increase in energy, and/or in an increase in one or more of focus, concentration, and memory. Water-soluble hydrolyzed clinoptilolite fragments can be combined with one or more dietary supplements, including various vitamins and sleep aids.

Abstract: A composition and an article of manufacture providing relief of indigestion, heartburn, GERD and some hangovers. The composition is an oleophilic colloidal suspension of a finely ground powder of USP calcium carbonate suspended in a usually tasteless edible oil; wherein the suspension has a weight ratio range of oil to calcium carbonate that is from about 1.0 (oil) to 0.25 (calcium carbonate) to about 1.0 (oil) to 2.2 (calcium carbonate); and a single dose has a calcium carbonate weight range from about 200 mg to about 1000 mg. The composition can include other foods and additives so that it may be used and dispensed in a plurality of delivery systems and foods. The oleophilic colloidal suspension can be dispensed as a soft-gel.

Abstract: The present invention is directed to methods and compositions regarding the preparation of an cell concentrate, such as, for example, an osteogenic cell concentrate, from a physiological solution, such as bone marrow aspirate, blood, or a mixture thereof. In specific embodiments, the invention provides methods and compositions utilizing two physiological solution-processing techniques, particularly in a point of care environment, wherein centrifugation is not employed.

Abstract: The present disclosure provides a method for treating an inflammatory neurological disease comprising administering a population of cells enriched for STRO-1+ cells and/or progeny thereof and/or soluble factors derived therefrom.

Abstract: The present disclosure relates to the acceleration of hematopoietic compartment reconstitution in a subject in need of hematopoietic stem cell transplantation by administering a composition having a protein transduction domain-MYC (PTD-MYC) fusion protein in combination with hematopoietic stem cell transplantation and to the enhancement of hematopoietic compartment autoreconstitution in a subject in need thereof by administering a composition having a protein transduction domain-MYC (PTD-MYC) fusion protein.

Abstract: The present disclosure provides methods for the treatment of a mammal having a neurological condition, disease, or injury. The methods involve increasing the number of functional GABAergic interneurons at or near the site of the neurological disease, injury, or condition.

Abstract: The present disclosure concerns methods and compositions for differentiating cells, including adipose cells, into chondrocyte-like cells via in vitro, ex vivo, and/or in vivo mechanical strain. In particular aspects, adipose cells or re-differentiated adipose cells that are chondrocyte-like cells, are delivered to a joint or are shaped into cartilage. In some embodiments, the adipose cells may be delivered to a joint, such as an intervertebral disc, following which the cells differentiate into chondrocyte-like cells to treat dysfunction of cartilage therein, including to repair degenerated discs, for example. In certain aspects, the cells prior to delivery to the individual are managed in the absence of growth factors, in vitro mechanical strain, and/or matrix molecules, for example.

Abstract: This disclosure relates to compositions comprising ascorbic acid and bone morphogenetic protein 4 (BMP-4) for growing cells and making tissues. In certain embodiments, this disclosure relates to methods of creating cardio-mimetic tissues (CMTs) by culturing the cells in the presence of ascorbic acid and bone morphogenetic protein 4 and optionally inserting into cells a muscle specific microRNA or related nucleobase polymer and under conditions such that a cardio-mimetic tissue is formed that is capable of spontaneously contracting.

Abstract: In one embodiment, the present invention relates to a method for reducing the frequency and/or severity of headache in a subject comprising administering to the subject a composition comprising the stromal vascular fraction or stromal cells of adipose tissue. In another embodiment, the present invention relates to a method for reducing the frequency and/or severity of headache in a subject comprising administering to the subject a composition compositing bone marrow. In another embodiment, the present invention relates to a method for reducing the frequency or severity of headache in a subject comprising administering to the subject a composition comprising adult stem cells.

Abstract: Pharmaceutical compositions are disclosed that includes a therapeutically effective amount of a purified viable gram negative bacteria and a pharmaceutically acceptable carrier. The pharmaceutical compositions are formulated for topical administration. Methods of treating atopic dermatitis using these pharmaceutical compositions are also disclosed.

Abstract: Disclosed herein are compositions that have substantially purified Christensenellaceae bacteria, and uses of these compositions to alter the microbiome of an individual. The addition of Christensenellaceae bacteria, such as Christensenella, to the microbiome of an individual can treat or prevent weight gain, reduce body weight, inhibit fat accumulation, reduce excess adiposity, and reduce a high body mass index (BMI), and can also treat or prevent conditions correlating with excess weight and fat and a high BMI, such as insulin sensitivity, metabolic syndrome, excess adiposity, and diabetes.

Abstract: The present disclosure provides methods of using probiotic arginolytic oral compositions including isolated arginolytic bacterial strains to increase arginolytic activity in the oral cavity, increase ammonia-producing bacteria in the oral cavity, and/or to treat and/or prevent oral disorders, such as caries.

Abstract: A method for preserving viral particles comprising: (a) providing an aqueous solution of (i) viral particles, (ii) optionally one or more sugars, and (iii) a compound of formula (I) or a physiologically acceptable salt or ester thereof and/or a compound of formula (II) or a physiologically acceptable salt or ester thereof; and (b) drying the solution to form a composition incorporating said viral particles.

Abstract: Compositions comprising metabolized conditioned growth medium and/or metabolized cell extract and methods of use are described. The metabolized conditioned growth medium and metabolized cell extract compositions may be formulated with an acceptable carrier into injectable or topical formulations, for example, as a cream, lotion or gel, and may be used in cosmeceutical or pharmaceutical applications. The metabolized conditioned growth medium and metabolized cell extract may also be further processed to concentrate or reduce one or more factors or components contained within the metabolized conditioned growth medium or metabolized cell extract. The growth medium may be conditioned by any eukaryotic cell. The metabolized conditioned growth medium and metabolized cell extract may be used to prevent or treat a condition, for example, a skin condition.

Abstract: A method of treating nail diseases by topically applying to the nails a composition containing undecylenic acid and tolnaftate, a urea-based component, a monohydric alcohol such as isopropanol, a diol such as propylene glycol, dimethyl isosorbide, and a carboxylic acid, preferably lactic acid.

Abstract: A novel process for incorporating cannabis extract in an emollient carrier. The carrier is a hydrophobic gel that helps to keep skin soft, smooth and hydrated.

Abstract: The present invention discloses synergistic nutraceutical or pharmaceutical or dietary supplement anti-inflammatory compositions comprising therapeutically effective combination of an extract selectively enriched in 3-O-acetyl-1 1-keto-?-boswellic acid (AKBA) derived from Boswellia serrata and Boswellia serrata non-acidic resin extract (BNRE). The composition(s) can be used to prevent, control and treat inflammation and several inflammatory related diseases including asthma, osteoarthritis, rheumatoid arthritis, endothelial dysfunction and the like. The invention further discloses the amelioration of pro-inflammatory biomarker proteins or molecules, whose expression/production is altered during inflammatory diseases.

Abstract: The present invention discloses the use of a lycopene coated with a water non-soluble thin film comprising amphiphilic protein polymer for coloring with red color, foods, pharmaceuticals or cosmetics having fat and/or oil contents higher than 5%. The invention further discloses a process for the preparation of stable lycopene formulation comprising (a) treating an isolated protein to form a protein in a molecular form; (b) dispersing lycopene in an aqueous solution comprising an isolated protein in a molecular form; (c) grinding said dispersion to form lycopene particle size of 1 to 10 ?m forming an homogenized mixture comprising fine particles; and optionally (d) drying the homogenized mixture.

Abstract: A method for inducing a proliferation of dopaminergic cells in a subject in need, comprising: administering a herbal medicinal composition to a subject in need, wherein the herbal medicinal composition comprises: Ginseng Radix, Glycyrrhiza uralensis, Zingiber officinale Roscoe, Cinnamomum cassia Presl., and Scutellariae Radix.

Abstract: A method of treating heart disease and/or injury in a subject includes administering to the subject a therapeutic agent that inhibits one or more of catalytic activity, signaling, and function of PTP?.

Abstract: A process for the preparation of injectable pharmaceutical compositions for the sustained release of somatostatin analogs and compositions prepared according to the process. The process may comprise lyophilizing a mixture of lanreotide acetate and acetic acid to form a lyophilizate and hydrating the lyophilizate, wherein the lyophilization is performed only once.

Abstract: The present invention relates to a peptide for preventing or treating inflammatory diseases and a use thereof. According to the novel dimeric or trimeric peptide according to the present invention, it is possible to not only exhibit an excellent therapeutic effect through anti-inflammatory action but also have a very small-sized peptide, thereby minimizing side effects due to the administration of external substances. Therefore, it is expected that the peptide can be used as an active substance that can replace existing therapeutic agents for inflammatory diseases.

Abstract: A PLG copolymer material, termed a PLG(p) copolymer material, adapted for use in a controlled release formulation for a bioactive material is provided, wherein the formulation exhibits a reduced “initial burst” effect when introduced into the tissue of a patient in need thereof. A method of preparation of the PLG copolymer material is also provided, as are methods of use.

Abstract: Disclosed herein are methods of formulating cyclosporin A Form 2.

Abstract: An anti-vascular diseases and antitumor pharmaceutical composition is provided in the present invention, and it includes effective ingredients including bleomycin antitumor antibiotic, adrenal glucocorticoid, epinephrine or pharmaceutically acceptable salts thereof in a weight ratio of (1-8):(2-5):(0.00005-0.001). The pharmaceutical composition provided can be used for treatment of vascular diseases and tumors.

Abstract: The present invention provides lyophilized formulations of active agents, particularly of TAT-NR2B9c, as chloride salts. TAT-NR2B9c has shown promise for treating stroke, aneurysm, subarachnoid hemorrhage and other neurological or neurotraumatic conditions. The chloride salt of TAT-NR2B9c shows improved stability compared with the acetate salt form of prior formulations. Formulations of the chloride salt of TAT-NR2B9c are stable at ambient temperature thus facilitating maintenance of supplies of such a formulation in ambulances for administration at the scene of illness or accident or in transit to a hospital.

Abstract: The present application discloses a method for treating microbial infection using an antimicrobial composition comprises antimicrobial peptide which contains at least one VGFPV motif.

Abstract: The present invention relates to C5 binding polypeptides, comprising a C5 binding motif, BM, which motif consists of an amino acid sequence selected from i) EX2X3X4A X6 X7EID X11LPNL X16X17X18QW X21AFIX25X26LX28D, and ii) an amino acid sequence which has at least 86% identity to the sequence defined in i), wherein the polypeptide binds to C5. The present invention moreover relates to C5 binding polypeptides for use in therapy, such as for use in treatment of a C5 related condition, and to methods of treatment.

Abstract: This disclosure relates to particles comprising recombinant proteins, pharmaceutical composition comprising the particles, and therapeutic uses related thereto. In certain embodiments, the particles are made by the process of producing recombinant proteins and conjugating the recombinant proteins to form nanoparticles with a linking reagent comprising disulfide bonds. Typically the recombinant protein has a polypeptide of viral, fungal, or bacterial origin such as secreted effector proteins AvrA and YopJ. In certain embodiments, the disclosure relates to treating or preventing autoimmune diseases, cancer, or inflammatory diseases, or conditions such as inflammatory bowel disease (IBD).

Abstract: Described herein are compositions and methods of using placental stem cell recruiting factors, more specifically, isolated placental stem cell recruiting factors. In one embodiment, isolated placental stem cell recruiting factors are delivered to a site such as a diseased or injured organ and/or body part in an amount sufficient to recruit stem cells to the site.

Abstract: A method of tightening inter-cellular junctions in endothelial or epithelial cells includes exposing the endothelial or epithelial cells to norrin. Upon sufficient contact time, for norrin to selectively up-regulate gene expression of Cadherin or claudin-5 in the endothelial or epithelial cells, the inter-cellular junctions are tightened.

Abstract: Disclosed is a method of treatment for anti-Alzheimer's disease based on an action mechanism associated with amyloid ? protein, which action mechanism is different from conventional action mechanisms. The treatment Alzheimer's disease uses a therapeutic agent for cognitive impairment induced by amyloid ? protein, which therapeutic agent comprises a peptide having the amino acid sequence represented by SEQ ID NO:1 or a peptide similar to this peptide, especially a peptide containing the amino acid sequence represented by SEQ ID NO:2, which is a partial sequence of SEQ ID NO:1. VLSSQQFLHRGHQPPPEMAGHSLASSHRNSMIPSAAT (SEQ ID NO:1) HRGHQPPPEMA (SEQ ID NO:2).

Abstract: Provided is an IL-15 heterodimeric protein, such as an IL-15/IL-15R? heterodimeric protein. The IL-15 heterodimeric protein contains protein (I) and protein (II). Protein (I) is recombinantly produced by combining IL-15 or a variant thereof with a first Fc variant, and protein (II) is a second Fc variant, or recombinantly produced by combining IL-15R? or a variant thereof with a second Fc variant. The first Fc variant and the second Fc variant are preferably linked via a “Knob-into-Hole” mode. Also provided are methods of using the IL-15 heterodimeric proteins to modulate an immune response. The provided IL-15 heterodimeric proteins have significant anti-tumor activity, better biological activity and prolonged in vivo half-life compared to the IL-15 molecule alone.

Abstract: A peptide with anti-inflammatory activity is described, wherein the peptide comprises at least one amino acid sequence among SEQ ID NO: 2 to SEQ ID NO: 179, the peptide has above 80% homology of amino acid sequence with above-mentioned sequences, or the peptide is the fragment of the above-mentioned peptides. The peptides that have at least one amino acid sequence of SEQ ID NO: 2 to SEQ ID NO: 179 shows outstanding efficacy in both suppressing inflammation and in prophylactic means. Therefore, the composition comprising those peptides can be used as anti-inflammatory pharmaceutical compositions or as cosmetic compositions, in turn, treating and preventing a variety of different types of inflammatory diseases.

Abstract: Wound debridement compositions containing the proteolytic enzyme Seaprose and use of such compositions in wound treatment for the enzymatic debridement of wounds.

Abstract: Provided are methods of enhancing an immune response and methods for reducing the recruitment of monocytes to a lymph node by administering to an individual an angiotensin II receptor blocker or a compound of Formula (I) in conjunction with an antigen. The invention also provides relate methods for amplifying vaccine immunity by administering to an individual an angiotensin II receptor blocker or a compound of Formula (I) in conjunction with an vaccine. The invention also provides related methods of inhibiting tumor growth and metastasis by administering to an individual with cancer an angiotensin II receptor blocker or a compound of Formula (I) in conjunction with an anti-tumor preparation. In addition, related compositions comprising an ARB or a compound of Formula (I) and an antigen, vaccine, or anti-tumor preparation are provided.

Abstract: Provided herein are attenuated Salmonella bacteria for expressing autoantigen alone or in combination with an immunomodulatory, as well as methods of using these bacteria to treat various autoimmune disorders.

Abstract: The present invention provides a cancer vaccine composition for mucosal administration for inducing cellular immunity, comprising (i) a WT1 peptide and/or a modified WT1 peptide; and (ii) a cellular immunity induction promoter. The composition efficiently induces cellular immunity against a cancer in a subject.

Abstract: This disclosure describes polypeptides fragments of annexin II, variants thereof, compositions that includes such fragments and/or variants, and methods of using such frag and/or variants.

Abstract: The present invention relates to a protein nanoparticle having a surface on which a cancer-specific epitope is fused and expressed, a method for producing the same, and a composition for cancer immunotherapy containing the protein nanoparticle as an active ingredient, and more specifically, to a recombinant microorganism into which a vector in which a promoter, a gene of a human ferritin heavy chain protein, and a gene encoding the cancer-specific epitope are operably linked is introduced, a protein nanoparticle in which a cancer-specific epitope is fused and expressed on a surface of the human ferritin heavy chain protein, a method of producing the protein nanoparticle, and a composition for cancer immunotherapy including the protein nanoparticle as the active ingredient, wherein the cancer-specific epitope on the surface of the protein nanoparticle according to the present invention is able to be expressed with correct orientation and high density, and the composition for cancer immunotherapy including the

Abstract: Compositions, methods of making, and methods of using, xenoantigen-displaying anti-cancer vaccines are described.

Abstract: Isolated CDCA1-derived epitope peptides having Th1 cell inducibility are disclosed herein. Such peptides can be recognized by MHC class II molecules and induce Th1 cells. In preferred embodiments, such a peptide of the present invention can promiscuously bind to MHC class II molecules and induce CDCA1-specific cytotoxic T lymphocytes (CTLs) in addition to Th1 cells. Such peptides are thus suitable for use in enhancing immune response in a subject, and accordingly find use in cancer immunotherapy, in particular, as cancer vaccines. Also disclosed herein are polynucleotides that encode any of the aforementioned peptides, APCs and Th1 cells induced by such peptides and methods of induction associated therewith. Pharmaceutical compositions that comprise any of the aforementioned components as active ingredients find use in the treatment and/or prevention of cancers or tumors.

Abstract: The present invention relates to compositions and methods for the prevention, treatment, and diagnosis of cancer, especially carcinomas, such as pancreatic carcinoma. The invention discloses peptides, polypeptides, and polynucleotides that can be used to stimulate a CTL response against pancreatic and other cancers.

Abstract: This invention provides an immunogenic composition including the supernatant of a Mycoplasma hyopneumoniae (M.hyo) culture, wherein the supernatant of the M.hyo culture has been separated from insoluble cellular material by centrifugation, filtration, or precipitation and is substantially free of both (i) IgG and (ii) immunocomplexes comprised of antigen bound to immunoglobulin.

Abstract: The subject relates to an isolated antibody that specifically binds to O25b antigen of multi drug resistant (MDR) E. coli strains, its medical and diagnostic use, method of producing the antibody, including an isolated nucleotide sequence, plasmids and host cells as used in the production of the antibody; and further an isolated epitope recognized the specific antibody.

Abstract: This invention provides a multivalent immunogenic composition including a soluble portion of a Mycoplasma hyopneumoniae (M.hyo) whole cell preparation; a porcine circovirus type 2 (PCV2) antigen; and a Lawsonia intracellularis antigen, wherein the soluble portion of the M.hyo preparation is substantially free of both (i) IgG and (ii) immunocomplexes comprised of antigen bound to immunoglobulin.

Abstract: The application generally relates to the attenuation of a RNA virus or of a clone thereof and involves the alteration of sequence space, more particularly the reduction, of mutational robustness of said RNA virus or clone. The means of the application are more particularly dedicated to the attenuation of an infectious RNA virus or clone, for the production of immunogenic composition or vaccine. More particularly, the means of the application involve the replacement of codon(s) by different codon(s), which is(are) selected to differ by only one nucleotide from a codon STOP, more particularly by different but synonymous codon(s), which is(are) selected to differ by only one nucleotide from a codon STOP.