Abstract: Isolated peptide sequences and proteins containing these sequences are provided which are useful in the prevention and treatment of infection caused by Gram-positive bacteria. The peptide sequences have been shown to be highly conserved motifs in the surface proteins of Gram-positive bacteria, and these consensus sequences include amino acid sequences such as LPXTG (SEQ ID NO:13), ALKTGKIDIIISGMTSTPERKK (SEQ ID NO:14), VEGAVVEKPVAEAYLKQN (SEQ ID NO:15), and EYAGVDIDLAKKIAK (SEQ ID NO:16). By virtue of the highly conserved regions, the sequences and the proteins including these sequences can be utilized to generate antibodies which can recognize these highly conserved motifs and the proteins containing them and thus be useful in the treatment or prevention of a wide range of infections caused by Gram-positive bacteria.

Abstract: The invention provides isolated polypeptide and nucleic acid sequences derived from Staphylococcus epidermidis that are useful in diagnosis and therapy of pathological conditions; antibodies against the polypeptides; and methods for the production of the polypeptides. The invention also provides methods for the detection, prevention and treatment of pathological conditions resulting from bacterial infection.

Abstract: A new fibrinogen binding protein or polypeptide originating from coagulase negative staphylococci, biotechnological methods for producing the protein or polypeptide having fibrinogen binding activity and a recombinant DNA molecule coding for the protein (or fragments thereof), and micro-organisms (including viruses) containing this recombinant DNA molecule. The present invention further comprises the therapeutic and diagnostic use of the protein and/or DNA, e.g., a diagnostic kit for determining the presence and/or type of coagulase negative staphylococci and a vaccine composition, comprising the protein or DNA.

Abstract: Mycobacterium strains in which the erp gene is modified, and vaccine compositions comprising such Mycobacterium strains are provided. The modification of the erp gene may decrease the virulence and the persistence of the Mycobacterium strains.

Abstract: The invention relates to Leptospiral surface proteins, and the nucleic acid molecules which encode them. Various uses are described, including immunoprophylactic, diagnostic and therapeutic methods.

Abstract: The invention relates to monoclonal antibodies capable of recognizing and neutralizing epitopes from the ligand domain, the translocation domain or the catalytic domain of the enterotoxin (toxin A) and cytotoxin (toxin B) from Clostridium difficile, as well as their production and therapeutic and prophylactic applications to diseases caused by said toxins.

Abstract: Compounds and methods for diagnosing tuberculosis are disclosed. The compounds provided include polypeptides that contain at least one antigenic portion of one or more M. tuberculosis proteins, and DNA sequences encoding such polypeptides. Diagnostic kits containing such polypeptides or DNA sequences and a suitable detection reagent may be used for the detection of M. tuberculosis infection in patients and biological samples. Antibodies directed against such polypeptides are also provided.

Abstract: This invention relates to compositions and methods which provide protection against, or reduce the severity of toxic shock and septic shock from bacterial infections. More particularly it relates to peptides derived from homologous sequences of the family of staphylococcal and streptococcal toxins, which may be polymeric, and carrier-conjugates thereof. The invention also relates to serum antibodies induced by the peptides and carrier-conjugates and their use to prevent, treat, or protect against the toxic effects of most, if not all, of the staphylococcal and streptococcal toxins. The invention also relates to diagnostic assays and kits to detect the presence of staphylococcal and streptococcal toxins, or antibodies thereto. The invention also relates isolated and purified to nucleic acids encoding the peptides of the invention and transformed host cells containing those nucleic acids.

Abstract: Monoclonal antibodies which can bind to the Fnbp protein of Staphylococcus aureus and which are generated from a peptide from the D2 region of fibronectin binding protein B (Fnbp) of S. aureus are provided which can be useful in the treatment and protection against infection from staphylococcal bacteria such as Staphylococcus aureus. The monoclonal antibodies of the invention are advantageous in that they bind S. aureus in high affinity and thus can be useful in the prevention of the adherence of staph bacteria to host cells by impairing or inhibiting the ability of S. aureus Fnbp to bind to fibronectin. Kits and methods of utilizing the monoclonal antibodies of the invention are also provided.

Abstract: The invention relates to Leptospiral surface proteins, and the nucleic acid molecules which encode them. Various uses are described, including immunoprophylactic, diagnostic and therapeutic methods.

Abstract: The invention relates to Leptospiral surface proteins, and the nucleic acid molecules which encode them. Various uses are described, including immunoprophylactic, diagnostic and therapeutic methods.

Abstract: Provided herein is an in vitro granuloma model and methods of its use. Methods of detecting and/or diagnosing latent tuberculosis in a subject are also provided, as are latency-specific antigens (and antibodies thereto), such as ?-crystallin, and methods of identifying and using such molecules. Also provided are immunostimulatory compositions, for instance for use in eliciting an immune response in a subject, such as an immune response to a latent tuberculosis infection. Kits for carrying out the provided methods are also described.

Abstract: A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO. 2) and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

Abstract: The invention relates to Mycobacterium tuberculosis superoxide dismutase antibodies, methods of using them for detection of M. tuberculosis, methods of testing for an inhibitor of an M. tuberculosis superoxide dismutase, and methods of detecting tuberculosis infection.

Abstract: Disclosed and claimed are: epitopic regions of Pneumococcal Surface Protein C or “PspC”, different clades of PspC, isolated and/or purified nucleic acid molecules such as DNA encoding a fragment or portion of PspC such as an epitopic region of PspC or at least one epitope of PspC, uses for such nucleic acid molecules, e.g., to detect the presence of PspC or of S. pneumoniae by detecting a nucleic acid molecule therefor in a sample such as by amplification and/or a polymerase chain reaction, vectors or plasmids which contain and/or express such nucleic acid molecles, e.g.

Abstract: Polyspecific immunoconjugates and antibody composites that bind a multidrug transporter protein and an antigen associated with a tumor or infectious agent are used to overcome the multidrug resistant phenotype. These immunoconjugates and composites also can be used diagnostically to determine whether the failure of traditional chemotherapy is due to the presence of multidrug resistant tumor cells, multidrug resistant HIV-infected cells or multidrug resistant infectious agents.

Abstract: Provided are CD-1 presented antigens, compositions, cells, inhibitors and methods relating to the use of hydrophobic antigen presentation by CD1 molecules, including: methods for detecting the presence of a CD1-presented hydrophobic antigen in a sample; methods for isolating such CD1-presented antigens and isolated antigens; vaccines containing CD1-presented antigens and vaccination methods; methods of blocking CD1 antigen presentation; methods of identifying and/or isolating CD1 blocking agents and the isolated CD1 blocking agents; methods of inducing CD1 expression; and T-cells for use in the methods disclosed herein.

Abstract: The invention relates to Leptospiral surface proteins, and the nucleic acid molecules which encode them. Various uses are described, including immunoprophylactic, diagnostic and therapeutic methods.

Abstract: The invention provides a nucleic acid encoding the 37-kDa protein from Streptococcus pneumoniae. Also provided are isolated nucleic acids comprising a unique fragment of at least 10 nucleotides of the 37-kDa protein. The invention also provides purified polypeptides encoded by the nucleic acid encoding the 37-kDa protein from and the nucleic acids comprising a unique fragment of at least 10 nucleotides of the 37-kDa protein. Also provided are antibodies which selectively binds the polypeptides encoded by the nucleic acid encoding the 37-kDa protein and the nucleic acids comprising a unique fragment of at least 10 nucleotides of the 37-kDa protein. Also provided are vaccines comprising immunogenic polypeptides encoded by the nucleic acid encoding the 37-kDa protein and the nucleic acids comprising a unique fragment of at least 10 nucleotides of the 37-kDa protein.

Abstract: The invention relates to Leptospiral surface proteins, and the nucleic acid molecules which encode them. Various uses are described, including immunoprophylactic, diagnostic and therapeutic methods.

Abstract: A vaccine, effective in inducing the production of antibodies with which to immunize a second subject passively against infection by Gram-negative bacteria and LPS-mediated pathology, comprises a non-covalent polyvalent complex formed between purified, detoxified LPS derived from E. coli and purified outer membrane protein derived from N. meningitidis. The same vaccine will also actively immunize a host subject against Gram-negative bacterial infections and LPS-mediated pathology. Meningococcal infections are included among those Gram-negative bacterial infections protected against by the vaccine.

Abstract: The invention relates to Leptospiral surface proteins, and the nucleic acid molecules which encode them. Various uses are described, including immunoprophylactic, diagnostic and therapeutic methods.

Abstract: The present invention provides an assay for detection of serum antibodies to M. paratuberculosis. A tracer, comprising a carbohydrate antigen isolated from M. paratuberculosis that is conjugated to a fluorophore, is added to a serum sample from an animal to form a mixture. The fluorescence polarization of the mixture is then measured. The presence of serum antibodies to M. paratuberculosis is indicated by a fluorescence polarization value of the mixture that is higher than the fluorescence polarization value of a control. The present invention further provides a tracer for use in a fluorescence polarization assay for antibodies specific for M. paratuberculosis. The tracer comprises a carbohydrate antigen isolated from M. paratuberculosis and conjugated to a fluorophore, such that the tracer is able to bind to antibodies specific for M. paratuberculosis to produce a detectable change in fluorescence polarization.

Abstract: A substantially pure capsular exopolysaccharide adhesin of coagulase-negative staphylococcal strains, and a gonoral method to prepare such adhesins, are described. Vaccines composed of such adhesins, and uses of such adhesins to produce polyclonal and monoclonal antibodies against such adhesins, are also disclosed. The adhesins are useful in coating polymoric medical materials to prevent colonization by coagulase-negative staphylococcal strains, and as a probe in selecting desirable polymeric medical materials. Such adhesin antibodies are useful in vivo to prevent infection by nosocomial coagulase-negative staphylococcal strains, in assays for the detection of such bacteria, in assays for the estimation of such adhesins in complex mixtures, and as an affinity chromatography matrix.

Abstract: The invention relates to the isolation of the fibrinogen binding protein gene from Staphylococcus aureus and to the use of the fibrinogen binding protein and antibodies generated against it for wound healing, blocking adherence to indwelling medical devices, immunization or diagnosis of infection.

Abstract: The subject of the invention is amino acid sequences of the AC-Hly from B. pertussis, B. parapertussis and/or B. bronchiseptica, carrying epitopes capable of inducing a protective immune response against infection by Bordetella. The subject of the invention is antibodies, especially monoclonal antibodies, directed against these epitopes.

Abstract: The invention relates to agents and processes for detecting bacteria of the genus Listeria, in particular L. monocytogenes. The agents according to the invention include primers whose sequence is selected from the iap gene of L. monocytogenes. In addition, the agents according to the invention include peptides whose sequence is selected from the p60 protein and which are suitable for producing specific antibodies for the immunological detection of L. monocytogenes.

Abstract: Compounds and methods for diagnosing tuberculosis are disclosed. The compounds provided include polypeptides that contain at least one antigenic portion of one or more M. tuberculosis proteins, and DNA sequences encoding such polypeptides. Diagnostic kits containing such polypeptides or DNA sequences and a suitable detection reagent may be used for the detection of M. tuberculosis infection in patients and biological samples. Antibodies directed against such polypeptides are also provided.

Abstract: The present invention relates to peptide sequences enabling mycobacteria to adhere to host cells (e.g., epithelial cells). More particularly, the invention relates to a mycobacterial heparin-binding haemagglutinin type antigen from M. bovis ECG or M. tuberculosis. The invention also relates to a recombinant peptide sequence enabling mycobacteria to adhere to host cells. The polypeptides can be used to prepare vaccines against mycobacterial infections and for serological diagnosis of mycobacterial infections.

Abstract: The present invention encompasses monoclonal and chimeric antibodies that bind to lipoteichoic acid of Gram positive bacteria. The antibodies also bind to whole bacteria and enhance phagocytosis and killing of the bacteria in vitro and enhance protection from lethal infection in vivo. The mouse monoclonal antibody has been humanized and the resulting chimeric antibody provides a previously unknown means to diagnose, prevent and/or treat infections caused by gram positive bacteria bearing lipoteichoic acid. This invention also encompasses a peptide mimic of the lipoteichoic acid epitope binding site defined by the monoclonal antibody. This epitope or epitope peptide mimic identifies other antibodies that may bind to the lipoteichoic acid epitope. Moreover, the epitope or epitope peptide mimic provides a valuable substrate for the generation of vaccines or other therapeutics.

Abstract: The present invention related to biotechnology and genetic engineering, particularly the expression of proteins of viral origin in microorganisms through their fusion by applying recombinant DNA technology to bacterial peptides. The present invention provides an effcient process for the expression in Escherichia coli of heterlogous proteins as fusion peptides with a view to obtaining them with a high degree of purity, in commercially useful amounts, and in an appropriate form for their inclusion in vaccine preparations. What is essentially used is a stabilizing sequence derived from the first 47 amino acids of the antigen P64k of Neisseria meningitides B:4:P1.15. In particular, use is made of a recombinant plasmid containing said sequence, under the control of the tryptophane promoter of E. coli and of the terminator of the transcription of the phage T4, including restrictions sites which provide for the cloning in phase of DNA fragments coding for polypeptides of interest.

Abstract: A novel peptide obtained from Haemophilus paragallinarum has been found useful for preventing avian infectious coryza. This polypeptide induces production of hemagglutination-inhibition antibody and prevents infection and onset of avian infectious coryza. The invention further provides a gene coding for the polypeptide, a recombinant vector for expression of this gene, a host transformed with this vector, a process for preparing the polypeptide in a host, a vaccine for avian infectious coryza comprising the polypeptide as an active ingredient, a monoclonal antibody obtained using the polypeptide as an immunogen, and a diagnostic agent and a therapeutic agent for avian infectious coryza using the peptide and the antibody.

Abstract: This invention provides methods, reagents, and kits that are useful for diagnosing infection by Giardia lamblia. The methods are based on the discovery of binding agents, including recombinant polyclonal antibodies, that bind to the ?-1-giardin antigen of G. lamblia.

Abstract: The present invention provides bacterial and fungal ABC transporter proteins, immunogenic fragments thereof, neutralising agents specific thereto and binding agents specific thereto for therapeutic and diagnostic use, together with diagnostic test methods, methods of same and kits for performing same. Also provided are immunodominant conserved antigens from gram positive staphylococci, together with neutralising and binding agents specific thereto for use in therapy and diagnosis, and methods of same. Also provided are Staphylococcal holomogues of IstA and IstB and immunogenic fragments thereof, and their uses in methods of treatment and diagnosis of the human or animal body.

Abstract: Means for detection of bacteria of the genus Taylorella and biological applications thereof are described. In particular, the detection of T. equigenitalis and the treatment or prevention of infections caused by bacteria of this species are disclosed. Monoclonal antibodies which recognize an epitope of a bacterium of the species T. equigenitalis are disclosed. These monoclonal antibodies may be used to detect T. equigenitalis with certainty and by means of a single test.

Abstract: The present invention relates to expression and assembly of foreign multimeric proteins—e.g., antibodies—in plants, as well as to transgenic plants that express such proteins. In one of several preferred embodiments, the generation and assembly of functional secretory antibodies in plants is disclosed. The invention also discloses compositions produced by the transgenic plants of the present invention and methods of using same.

Abstract: The present invention provides an accurate method to identify and quantify the Borrelia burgdorferi (Bb) antigen, the cause of Lyme Disease, in a sample of whole blood, body tissues and fluids of a subject, a human or animal subject. The qualitative method provides a quick, easy and accurate method of detection of the Bb antigen. The quantitative method allows for monitoring of treatment in conjunction with severity of clinical signs and symptoms.

Abstract: A method of inhibiting, moderating or diagnosing Pseudomonas aeruginosa infection is disclosed. In one embodiment, this method comprises inoculating a patient with an effective amount of PcrV antigen.

Abstract: A food product and method for treating and preventing diarrhea in a subject animal suffering from or susceptible to diarrhea. The method comprises administering an egg product to the subject animal wherein the egg product is obtained from a hyperimmunized avian.

Abstract: The invention provides methods for screening for the presence of a clinically relevant amount of bacteria in donor blood or a blood product from a donor mammal, particularly blood or a blood product that will be transferred from the donor mammal to a recipient mammal. The method comprises contacting a sample of the donor blood or a blood product with a set of binding agents that comprises binding agents that specifically bind to Gram-negative bacterial antigen and/or binding agents that specifically bind to Gram-positive bacterial antigen, and determining binding of the set of binding agents to the sample, wherein binding indicates the presence of a clinically relevant amount of Gram-positive bacteria and/or Gram-negative bacteria in the donor blood or blood product and no binding indicates the absence of a clinically relevant amount of Gram-positive bacteria and/or Gram-negative bacteria in the donor blood or blood product.

Abstract: The gene for Streptococcus pyogenes DNase B has been cloned and vectors incorporating the cloned DNA have been used to transform Escherichia coli, allowing efficient and rapid production of the DNase in E. coli without the necessity of growing large quantities of S. pyogenes. The enzyme can be produced with a leader peptide at its aminoterminus. An improved method for the purification of naturally occurring S. pyogenes DNase B enzyme is also provided. The DNase B enzyme produced, either by purification of naturally occurring enzyme or by recombinant DNA techniques, can be used to generate antibodies and can also be used in immunochemical assays to detect the presence of anti-DNase B antibodies in serum as a marker of infection by S. pyogenes.

Abstract: A pharmaceutical composition for treating Lyme disease contains an antibody as an active agent which is specific for the 24 kDa antigen (OspC) of B. burgdorferi, preferably an antibody which is specific for the 24 kDa antigen (OspC) of B. burgdorferi having the sequence shown in SEQ ID NO.2.

Abstract: The invention relates to a method for identifying a Mycobacterium species comprising the steps of: a) contacting at least one immuno-cross reactive antigen component of a mycobacterial species with a sample of a body fluid of a human or animal individual; b) contacting at least one antibody, which is capable of reacting with a mycobacterial antigen, with said body fluid sample; c) detecting the presence of antigen-antibody complexes, and identifying the Mycobacterium species present in said body fluid sample.

Abstract: The present invention is directed to a method for purifying polysaccharides capable of inducing the production of high titers of opsonic antibodies that kill strains of enterococcal bacteria. In addition, the invention is directed to the antigens produced by this purification method and to vaccines which utilize such antigens.

Abstract: The present invention relates to an immunogenic conjugate comprising a carrier molecule coupled to an autoinducer of a Gram negative bacteria. The immunogenic conjugate, when combined with a pharmaceutically acceptable carrier, forms a suitable vaccine for mammals to prevent infection by the Gram negative bacteria. The immunogenic conjugate is also used to raise and subsequently isolate antibodies or binding portions thereof which are capable of recognizing and binding to the autoinducer. The antibodies or binding portions thereof are utilized in a method of treating infections, a method of inhibiting autoinducer activity, and in diagnostic assays which detect the presence of autoinducers or autoinducer antagonists in fluid or tissue samples.

Abstract: A method and composition for the passive immunization of patients infected with or susceptible to infection from Staphylococcus bacteria such as S. aureus and S. epidermidis infection is provided that includes the selection or preparation of a donor plasma pool with high antibody titers to carefully selected Staphylococcus adhesins or MSCRAMMs, or fragments or components thereof, or sequences with substantial homology thereto. The donor plasma pool can be prepared by combining individual blood or blood component samples which have higher than normal titers of antibodies to one or more of the selected adhesins or other proteins that bind to extracellular matrix proteins, or by administering carefully selected proteins or peptides to a host to induce the expression of desired antibodies, and subsequently recovering the enhanced high titer serum or plasma pool from the treated host.

Abstract: Reagents and methods for the detection of Staphylococcus aureus are provided. The reagents contain an antibody that binds to a capsular polysaccharide of type 5 of Staphylococcus aureus, and can be used in methods for detection of oxacillin resistant Staphylococcus aureus that escapes detection by agglutination in the presence of fibrinogen and antibodies directed against protein A of Staphylococcus.

Abstract: The invention provides active and passive immunization methods for preventing and treating Clostridium difficile infection, which involve percutaneous administration of C. difficile toxin-neutralizing polyclonal immune globulin, C. difficile toxoids, or combinations thereof. Also provided by the invention are C. difficile toxoids, C. difficile toxin-neutralizing polyclonal immune globulin, and methods of identifying subjects that produce C. difficile toxin-neutralizing polyclonal immune globulin.

Abstract: Isolated antibodies to Invaplex; novel compositions comprising immunoglobulins directed to invasin proteins and LPS from gram negative bacteria that selectively bind to Invaplex, and do not bind to the individual components of Invaplex.

Abstract: The invention relates to peptide, oligopeptide or polypeptide compounds that are capable of eliciting a protective immune response against the capsular polysaccharide of group B Streptococcus (GBS), particularly type III GBS. Such compounds are useful in the development of vaccines that are effective against diseases caused by these pathogens.