Abstract: This description provides methods and materials related to modulating Toll-like receptor activity. For example, methods and materials for increasing or decreasing the responsiveness of a TLR4 polypeptide are provided.

Abstract: Disclosed are antagonists of IL-17A and IL-17F. The antagonists are based on soluble IL-17RA and IL-17RC fusion proteins, including hybrid soluble receptors comprising portions of both IL-17RC and IL-17RA (“IL-17RC/IL-17RA”). Such antagonists serve to block, inhibit, reduce, antagonize or neutralize the activity of IL-17F, IL-17A, or both IL-17A and IL-17F. Also disclosed are methods of using such antagonists for treating disease, particularly inflammatory diseases mediated at least in part by IL-17A and/or IL-17F.

Abstract: The invention concerns compounds, compositions and methods for the treatment of skin cells. Described herein are CD109 polypeptides and uses thereof for the in vivo treatment of various skin disorders, including skin fibrosis, skin scarring, wound healing and psoriasis.

Abstract: There is disclosed a pharmaceutical composition and method for treating sepsis, including septic shock and ARDS (acute respiratory distress syndrome), comprising administering an effective amount of a HMG1 antagonist. There is further disclosed a diagnostic method for monitoring the severity or potential lethality of sepsis or septic shock, comprising measuring the serum concentration of HMG1 in a patient exhibiting or at risk of exhibiting sepsis or septic shock symptoms. Lastly, there is disclosed a pharmaceutical composition and method for effecting weight loss or treating obesity, comprising administering an effective amount of HMG1 or a therapeutically active HMG1 fragment.

Abstract: The present invention relates to a peptide of general formula (I): R1-(AA)n-X1-Gly-Glu-Leu-Ser-X2-X3-(AA)p-R2, derived from human HMG-CoA reductase. The present invention also relates to a cosmetic or pharmaceutical composition comprising at least one peptide of general formula (I), in a physiologically suitable medium. The present invention further relates to the use of this novel peptide as an active principle that activates human HMG-CoA reductase in a cosmetic composition intended to strengthen the barrier function of the skin and to stimulate epidermal differentiation. The invention further applies to a cosmetic treatment method intended to prevent and/or combat the external stresses and signs of cutaneous aging.

Abstract: The present invention relates to the management of vaginal health. In particular, the present invention relates to pharmaceutical compositions, and methods of use thereof, for treating diseases associated with compromised boundary lubrication at the vaginal epithelium.

Abstract: The present invention relates to the use of compounds selected from the group consisting of Lys-(D)Pro-Thr, N-acyl Lys-(D)Pro-Thr, C-amide Lys-(D)Pro-Thr, and C-esters of Lys-(D)Pro-Thr; or a pharmaceutically acceptable salt of said compound fort he treatment of inflammatory disorders. The invention also relates to the use of ?MSH for inducing tolerance.

Abstract: The invention pertains to methods and compositions for treating medical disorders characterized by elevated levels or abnormal expression of TNF? by administering a TNF? antagonist, such as recombinant TNFR:Fc.

Abstract: A composition comprising a content of a lysozyme and a content of a C-1/C-4 polysaccharide is useful in oral care, cosmetology and dermatology, contraception, urology and gynecology. It is emphasized that this abstract is provided to comply with the rules requiring an abstract which will allow a searcher or other reader quickly to ascertain the subject matter of the technical disclosure. It is submitted with the understanding that it will not be used to interpret or limit the scope or meaning of the appended issued claims. 37 CFR §1.72(b).

Abstract: The invention relates to a method of treatment for states related to inhibition of angiogenesis and endothelial cell proliferation comprising administering an effective amount of vimentin or its derivatives or its fragments, to a subject in need thereof. Further, the invention relates to a pharmaceutical composition and a medicament comprising vimentin, as well as the use of vimentin in the manufacture of a medicament. Hereby, angiogenesis and endothelial cell proliferation can be controlled, and therapeutic treatment for related states is provided.

Abstract: The invention relates to a heat shock protein from alfalfa and/or a hydrolysate of a heat shock protein from alfalfa in the manufacture of a food product for the prophylactic or therapeutic treatment of a chronic inflammatory disorder. Further, the invention relates to a clinical food product comprising heat shock protein from alfalfa and/or a hydrolysate of a heat shock protein from alfalfa.

Abstract: Disclosed are methods for the treatment and/or prevention of Type 2 diabetes, insulin resistance and disease states and conditions characterized by insulin resistance, obesity, hyperglycemia, hyperinsulinemia and Type 1 diabetes, comprising administering to a subject an effective amount of anti-IL-1? antibody or fragment thereof.

Abstract: The present invention relates to a soothing cosmetic or pharmaceutical composition comprising at least one peptide that activates human HMG-CoA reductase of general formula (I): R1-(AA)n-X1-Gly-Lys-X2-(AA)p-R2 and sequence SEQ ID No. 1 to SEQ ID No. 10, in a physiologically suitable medium. The present invention further relates to the utilization of this novel peptide as a soothing active principle in a cosmetic composition. The invention further applies to a cosmetic treatment method intended to combat skin irritations.

Abstract: Nucleic acids encoding mammalian, e.g., primate, receptors, purified receptor proteins and fragments thereof. Antibodies, both polyclonal and monoclonal, are also provided. Methods of using the compositions for both diagnostic and therapeutic utilities are described.

Abstract: The invention provides isolated Pre-Ligand Assembly Domain (PLAD) polypeptides comprising an amino acid sequence of a domain (e.g., a Fibronectin Ill-like domain) of an IL-17 Receptor (IL-17R) family member, wherein the PLAD polypeptide inhibits multimerization of a receptor complex comprising an IL-17R family member. Also provided are isolated PLAD-binding polypeptides, e.g., antibodies and avimers, which specifically bind to a PLAD polypeptide described herein. Related chimeric proteins, conjugates, nucleic acids, vectors, and host cells are provided herein. Further provided are methods of treating an inflammatory or autoimmune disease, methods of inhibiting IL-17-mediated signal transduction, methods of inhibiting IL-17 ligand binding, methods of inhibiting multimerization of IL-17R complexes, and methods of inhibiting the production of at least one cytokine, chemokine, matrix metalloproteinase, or other molecule associated with IL-17 signal transduction are provided.

Abstract: The instant invention provides a method of treating an animal suffering a disease characterized by excessive apoptosis by administering a therapeutically effective amount of at least one serine protease inhibitor and thereafter monitoring a decrease in apoptosis. The inhibitor of the invention includes ?1-antitrypsin or an ?1-antitrypsin-like agent, including, but not limited to oxidation-resistant variants of ?1-antitrypsin, and peptoids with antitrypsin activity. The diseases treatable by the invention include cancer, autoimmune disease, sepsis neurodegenerative disease, myocardial infarction, stroke, ischemia-reperfusion injury, toxin induced liver injury and AIDS. The method of the invention is also suitable for the prevention or amelioration of diseases characterized by excessive apoptosis.

Abstract: The present invention relates to a soothing cosmetic or pharmaceutical composition comprising at least one peptide that activates human HMG-CoA reductase of general formula (I): R1-(AA)n-X1-Gly-Glu-Leu-Ser-X2-X3-(AA)p-R2 and a physiologically suitable medium. The present invention further relates to the utilization of this novel peptide as a soothing active principle in a cosmetic composition. The invention further applies to a cosmetic treatment method intended to combat skin irritations.

Abstract: The present invention relates to the use of a 2,5-dihydroxybenzene derivative of formula (I) or a pharmaceutically acceptable salt, solvate, isomer, or prodrug thereof for the treatment and/or prophylaxis of, inter alia, psoriasis.

Abstract: Peptide compositions comprising a dimeric peptide which combines two peptide monomers, each independently comprising the amino acid sequence: Asp-X1-X2-Asn-Tyr-Ile-Thr-X3 wherein: X1 is selected from the group consisting of Cys and a Cys derivative; X2 is selected from the group consisting of Cys and a Cys derivative; and X3 is selected from the group consisting of Arg and Glu-Leu-Arg, provided that at least one of X1 and X2 is Cys, whereby a mol percentage of the dimeric peptide in the composition is at least 50 mol percents, or at least 99 mol percents, are disclosed. Further disclosed are processes of preparing such peptide compositions and uses thereof in the treatment of allergic disorders.

Abstract: Peptides of general formula (I): R1-Wp-Xn-AA1-AA2-AA3-AA4-Ym-R2 their stereoisomers, mixtures thereof, and/or their cosmetically or pharmaceutically acceptable salts, a method of preparation, cosmetic or pharmaceutical compositions containing them and their use for the treatment, prevention and/or care of conditions, disorders and/or diseases of the skin, mucous membranes and/or scalp.

Abstract: Chimeric therapeutics are disclosed that include a modified viral core protein and a nucleic acid bound to the modified viral core protein. The nucleic acid may be substantially homologous to a specific gene target. In some embodiments, the nucleic acid bound to the modified viral core protein is substantially non-immunogenic. Also disclosed are particles and compositions that include disclosec chimeric therapeutics.

Abstract: The present invention provides a method and composition for the treatment and prevention of an autoimmune disease such a multiple sclerosis which is mediated by autoreactive T cells. The administration of a NOD-1 agonist is shown to mediate an anti-inflammatory immune response. NOD-1 agonists suitable for use in the methods and compositions of the invention include diaminopimelic acid (DAP)-containing muropeptide compounds such as Tri-DAP and M-TriDAP.

Abstract: The instant invention describes macrocyclic compounds having therapeutic activity, and the mechanism and methods of treating disorders such as autoimmune diseases, inflammation, and cancer, tumors and cell proliferation related disorders.

Abstract: The invention relates to peptides and peptide derivatives of the following general Formulas (Ia) and (Ib) as well as in particular anti-inflammatory drugs containing these peptides.

Abstract: The subject invention pertains to peptides and salts thereof that are useful as anti-inflammatory agents and to compositions containing such peptides and salts as active ingredients. Specifically exemplified herein are endomorphin-1 peptide (EM-1), analogs and salts thereof, and uses for modulation of calcitonin gene-related peptide (CGRP) production and/or substance P (SP) and for treatment of inflammation, particularly neurogenic inflammation.

Abstract: The invention features polypeptide and polynucleotide sequences based on the 134R sequence. In some embodiments, these sequences include a heterologous signal sequence, such as the myxoma virus T7 signal sequence. The invention also features methods for treating immunological disorders and neoplasms (e.g., cancer) using the polypeptides and nucleotides described herein. Finally, the invention features fusion proteins including the myxoma virus T7 signal sequence.

Abstract: The present invention relates to a polypeptide, described as a lectin, its encoding nucleic acid sequence and antibodies to the polypeptide and their use in various medical applications, particularly for treating or preventing an autoimmune disorder, an inflammatory disorder or damaged skin in an animal.

Abstract: Follistatin-like protein (FSTL-1) is a secreted glycoprotein of unknown function, first isolated from mouse osteoblastic cells as a transforming growth factor-?1-inducible gene. The inventors have discovered that FSTL-1 is a proinflammatory mediator. As such, the invention provides for composition and methods of using agents that bind to FSTL-1 to modulate various types of inflammation (e.g., autoimmune diseases). Inhibitors and antagonists of FSTL-1, particularly antibodies or antibody fragments, may be used to treat conditions related to inflammation, such as arthritis. In addition, the inventors have discovered that FSTL-1 has a role in the Th17 pathway. Accordingly, the invention provides for compositions and methods of using agents which bind to FSTL-1 to modulate the generation of Th17 cells. Such agents are useful for delaying development of and treating diseases associated with undesired production of Th17 cells, such as autoimmune diseases.

Abstract: The invention relates to a method for the cosmetic prevention and/or treatment of stretch marks on the skin, characterised in that the method comprises administering a composition containing arabinogalactan as an active principle to a person that may develop or has stretch marks. Said cosmetic composition can be administered in a topical or oral manner.

Abstract: Use of hPTH-1-37 having the amino acid sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID No. 1) or one of its natural and pharmacologically compatible derivatives, especially amidated, acylated, phosphorylated and glycosylated derivatives, for preparing a medicament for the treatment of inflammatory scaling (erythematosquamous) diseases, especially psoriasis, wherein hPTH-1-37 (SEQ ID No. 1) is present in an amount of from 300 ?g to 30 mg per gram of medicament.

Abstract: Disclosed herein, in certain embodiments, is a method for treating an MIF-mediated disorder. In some embodiments, the method comprises administering an active agent that inhibits (i) MIF binding to CXCR2 and CXCR4 and/or (ii) MIF-activation of CXCR2 and CXCR4; (iii) the ability of MIF to form a homomultimer; or a combination thereof.

Abstract: Activated fatty acids, topical compositions including activated fatty acids and methods for using activated fatty acids to treat a variety of diseases.

Abstract: The present inventions are directed to compositions and methods regarding the reprogramming of biological samples (such as cells) without introducing exogenous genes to the samples. In particular, the present inventions are directed to transducible materials that are capable of transducing into the biological samples but are not genes or causing genetic modifications. The present inventions also are directed to methods of reprogramming the path of biological samples or treating diseases using the tranducible compositions thereof.

Abstract: The present invention relates to a composition comprising a Ninjurin1 expression or activity inhibitor for the prevention and treatment of inflammatory disease. Ninjurin1 protein is specifically expressed in macrophages around blood vessels, increases cell-cell adhesion and cell-matrix adhesion, increases expressions of Wnt7b (Wingless-type MMTV integration site family, member 7B) and Ang2 (angiopoietin-2), but reduces expression of Ang1 to induce apoptosis of vascular endothelial cells. In addition, Ninjurin1 protein is up-regulated when inflammation is induced and induces iNOS expression as well as increased NO generation. Therefore, the Ninjurin1 protein expression or activation inhibitor can be effectively used as an active ingredient of a composition for the prevention and treatment of inflammatory disease.

Abstract: The described invention provides methods and compositions utilizing a NELL1 peptide or nucleic acid encoding a NELL1 peptide for treating or preventing a skin condition. The methods include treating or preventing manifestations of aging in human skin, repairing damage to skin, and preventing skin scarring. Methods are also provided for assaying a test peptide for NELL1 activity.

Abstract: Described herein are peptide derivatives and peptidomimetics as inhibitors for transglutaminases, methods for their preparation, pharmaceutical compositions containing said compounds as well as uses of said transglutaminase inhibitors in particular for the treatment of coeliac disease and transglutaminase dependent diseases.

Abstract: Cell penetrating suppressor of cytokine signaling (CP-SOCS) molecules engineered to be resistant to intracellular degradation are discussed. Methods of treating diseases associated with cytokine signaling include one or more CP-SOCS degradation resistant molecules.

Abstract: The invention provides methods for the treatment of diseases and conditions mediated by increased phosphorylation, such as inflammation and cancer. The invention also provides methods for the inhibition of increased phosphorylation in cells, tissues and organs. The methods utilize a phosphate acceptor compound (PAC). The invention also provides products comprising a PAC.

Abstract: The invention relates to methods of use of synthetic peptide amides that are ligands of the kappa opioid receptor in the treatment and prevention of kappa opioid receptor-associated diseases and conditions; and particularly to uses of these agonists in the prophylaxis, inhibition and treatment of pain, inflammation and pruritis associated with a variety of diseases, disorders and conditions. Inflammatory conditions preventable or treatable by the methods of the invention include diseases and conditions associated with elevated levels of a proinflammatory cytokines, such as TNF-?, IL-?, IL-6, MMP-1 and MMP-3.

Abstract: It is an object to provide a radical scavenger, an active oxygen-scavenging agent and the like, which are highly efficacious clinically and novel, and so as to attain the object, 3,4-dihydroxyphenylalanine derivatives such as N-?-alanyl-5-S-glutathionyl-3,4-dihydroxyphenylalanine (5-S-GAD) or pharmaceutically acceptable salts thereof are contained as an active ingredient.

Abstract: The invention features methods of using serum factors such as Apolipoprotein A2 and Apolipoprotein C3 for reducing or preventing a chronic or acute inflammatory response (e.g., an inflammatory response due to an autoimmune disease or an injury).

Abstract: Preventing skin aging by targeting multiple causes by a single bullet is of primal scientific and consumer interest.

Abstract: Compounds comprising R-G-Cysteic Acid (i.e., R-G-NH—CH(CH2—SO3H)COOH or Arg-Gly-NH—CH(CH2—SO3H)COOH) and derivatives thereof, including pharmaceutically acceptable salts, hydrates, stereoisomers, multimers, cyclic forms, linear forms, drug-conjugates, pro-drugs and their derivatives. Also disclosed are methods for making and using such compounds including methods for inhibiting cellular adhesion to RGD binding sites or delivering other diagnostic or therapeutic agents to RGD binding sites in human or animal subjects.

Abstract: The present invention describes a protein hydrolysate which is rich in tripeptides whereby the tripeptides are rich in proline at one end of the peptide.

Abstract: Topical compositions to treat inflammatory skin conditions such as psoriasis comprise an effective amount of S-acyl glutathione derivative and a carrier. Methods for treating inflammatory skin conditions such as psoriasis comprise applying a composition containing S-acyl glutathione derivative in a dermatologically acceptable carrier to skin tissue. The acyl group is a saturated or unsaturated aliphatic C12-C24 group, preferably an unsaturated C16-C24 group, most preferably an unsaturated C18 group. In particularly preferred embodiments, the acyl group is a linoleoyl group.

Abstract: The present invention provides anti-inflammatory compounds, pharmaceutical compositions thereof, and methods of use thereof for treating inflammatory disorders. The present invention also provides methods of identifying anti-inflammatory compounds and methods of inhibiting NF-?B-dependent target gene expression in a cell.

Abstract: Topical compositions to prevent and to treat skin aging comprise an effective amount of S-acyl glutathione derivative and a carrier. Methods for preventing and treating skin aging comprise applying a composition containing S-acyl glutathione derivative in a dermatologically acceptable carrier to skin tissue. The acyl group is a saturated or unsaturated aliphatic C12-C24 group, preferably an unsaturated C16-C24 group, most preferably an unsaturated C18 group. In particularly preferred embodiments, the acyl group is a linoleoyl group.

Abstract: The invention provides methods of treating a mammal afflicted with an inflammatory disease, such as peritonitis, peritoneal adhesions or endometriosis, comprising the administration, intraperitoneal or otherwise, of a therapeutically effective amount of a SPARC polypeptide or a SPARC polypeptide-encoding isolated polynucleotide and a pharmacologic carrier.

Abstract: This disclosure provides a multi-target fusion protein composed of a TNF-? antagonist domain and another binding domain antagonistic for a heterologous target, such as IL6, RANKL, IL7, IL17A/F, TWEAK, CSF2, IGF1, IGF2 or BLyS/APRIL, or agonistic for a heterologous target, such as IL10. The multi-specific fusion protein may also include an intervening domain that separates the binding domains and allows for dimerization. This disclosure also provides polynucleotides encoding the multi-specific fusion proteins, compositions of the fusion proteins, and methods of using the multi-specific fusion proteins and compositions.

Abstract: The invention relates to histamine binding proteins. The invention also relates to the use of such histamine binding proteins in the treatment and prevention of diseases.