Insulin Or Derivative Utilizing Patents (Class 514/5.9)
  • Patent number: 10782305
    Abstract: Methods are described for measuring the amount of C peptide in a sample. More specifically, mass spectrometric methods are described for detecting and quantifying C peptide in a sample utilizing on-line extraction methods coupled with tandem mass spectrometric or high resolution/high accuracy mass spectrometric techniques.
    Type: Grant
    Filed: June 3, 2019
    Date of Patent: September 22, 2020
    Assignee: Quest Diagnostics Investments Incorporated
    Inventors: Nigel Clarke, Zhaohui Chen
  • Patent number: 10758519
    Abstract: It is intended to provide a drug, a quasi-drug, a dermatological preparation for external use, or a material to be contained to drugs, quasi-drugs, dermatological preparations for external use, food products, or the like which has an excellent UCP-1 expression-promoting action and promotes conversion of adipose to brown adipose (browning). The present invention provides a UCP-1 expression promoter comprising a PPAR? activator and a Smad3 inhibitor in combination. The present invention also provides a UCP-1 expression promoter comprising a PPAR? activator, a Smad3 inhibitor, and a ?3 adrenaline receptor activator or a TGR5 activator in combination.
    Type: Grant
    Filed: June 23, 2015
    Date of Patent: September 1, 2020
    Assignee: Kao Corporation
    Inventors: Satomi Kiuchi, Takatoshi Murase
  • Patent number: 10647753
    Abstract: An insulin analog with an improved in vitro effect compared with native insulin, a pharmaceutical composition for treating diabetes containing the insulin analog as an active ingredient, and a method for treating diabetes using the insulin analog or the pharmaceutical composition are described. A nucleic acid encoding the insulin analog, an expression vector including the nucleic acid, a transformant introduced with the expression vector, and a method of producing the insulin analog from the transformant are also described.
    Type: Grant
    Filed: May 25, 2018
    Date of Patent: May 12, 2020
    Assignee: HANMI PHARM. CO., LTD.
    Inventors: Jin Young Kim, Euh Lim Oh, Jong Soo Lee, Hyung Kyu Lim, In Young Choi, Se Chang Kwon
  • Patent number: 10584156
    Abstract: A two-chain insulin analogue contains an A chain modified by (i) a monomeric glucose-binding element at or near its N terminus and (ii) a B chain modified by at or near its C terminus by an element that reversibly binds to the monomeric glucose-binding element such that this linkage is displaceable by glucose. The monomeric glucose-binding element may be phenylboronic acid derivative (optionally halogenated). The B chain may be modified by a diol-containing element derived from a monosaccharide, disaccharide or oligosaccharide, a non-saccharide diol-containing moiety or a ?-hydroxycarboxylate-containing moiety. The analogue can be manufactured by trypsin-mediated semi-synthesis. Formulations can be at strengths U-10 to U-1000 in soluble solutions at pH 7.0-8.0 with or without zinc ions at a molar ratio of 0.0-3.0 ions per insulin analogue monomer.
    Type: Grant
    Filed: March 14, 2016
    Date of Patent: March 10, 2020
    Assignee: Case Western Reserve University
    Inventor: Michael Weiss
  • Patent number: 10398781
    Abstract: Conjugates which comprise a drug and a ligand which includes a first saccharide; wherein the conjugate is characterized in that, when the conjugate is administered to a mammal, at least one pharmacokinetic or pharmacodynamic property of the conjugate is sensitive to serum concentration of a second saccharide. Exemplary conjugates and sustained release formulations are provided in addition to methods of use and preparation.
    Type: Grant
    Filed: August 18, 2017
    Date of Patent: September 3, 2019
    Assignee: SMARTCELLS, INC.
    Inventors: Todd C. Zion, Thomas M. Lancaster
  • Patent number: 10392429
    Abstract: A single-chain insulin comprises a C-domain of 6 to 11 amino acid residues comprising at least two acidic residues at the N-terminal side of the C-domain and at least two basic residues at the C-terminal side of the C-domain peptide, a basic amino acid residue at the position corresponding to A8 of human insulin, and an acidic amino acid residue at the position corresponding to A14 of human insulin. The C-domain may contain a 2 to 4 amino acid joint region between the acidic and basic residues. Residues C1 and C2 may have a net negative charge of ?1 or ?2; and the remaining C-domain segment may culminates with two basic residues. A pharmaceutical composition comprises the single-chain insulin, formulated at a pH within the range 7.0 to 8.0, and may be formulated at a concentration of 0.6 mM to 5.0 mM and/or at a strength of U-100 to U-1000.
    Type: Grant
    Filed: October 6, 2015
    Date of Patent: August 27, 2019
    Assignee: Case Western Reserve University
    Inventor: Michael Weiss
  • Patent number: 10309972
    Abstract: Methods are described for measuring the amount of C peptide in a sample. More specifically, mass spectrometric methods are described for detecting and quantifying C peptide in a sample utilizing on-line extraction methods coupled with tandem mass spectrometric or high resolution/high accuracy mass spectrometric techniques.
    Type: Grant
    Filed: January 28, 2019
    Date of Patent: June 4, 2019
    Assignee: Quest Diagnostics Investments Incorporated
    Inventors: Nigel Clarke, Zhaohui Chen
  • Patent number: 10258573
    Abstract: A method of preparing an inhalable insulin suitable for pulmonary delivery includes: dissolving an insulin raw material in an acidic solution to form a dissolved insulin solution; titrating the dissolved insulin solution with a buffer solution to form a suspension comprising micronized insulin particles; and stabilizing the micronized insulin particles.
    Type: Grant
    Filed: July 8, 2015
    Date of Patent: April 16, 2019
    Assignee: Amphastar Pharmaceuticals, Inc.
    Inventors: Jeffrey Ding, Aili Bo, Mary Ziping Luo, Jack Yongfeng Zhang
  • Patent number: 10245241
    Abstract: A nasal irrigation solution (or composition) for pre- and post-operation sinus surgery and for use as a daily nasal cleanser. The composition, which may be in a powder form, may include lactated ringers with xylitol. This composition may be mixed with sterile water prior to nasal irrigation.
    Type: Grant
    Filed: June 1, 2016
    Date of Patent: April 2, 2019
    Inventors: Nina S Yoshpe, Ayal Willner, Rafael Akyuz
  • Patent number: 10172796
    Abstract: Novel encapsulated umirolimus and umirolimus polymer conjugate formulations having enhanced permeability and retention at tumor sites. Also provided are methods for treating cancer by administering the umirolimus formulations.
    Type: Grant
    Filed: December 2, 2013
    Date of Patent: January 8, 2019
    Assignee: Manli International Ltd.
    Inventors: Ting-Bin Yu, Shih-Horng Su
  • Patent number: 10143725
    Abstract: Methods for treating pain using a protein solution comprising two or more of IL1-ra, sTNF-R1, sTNF-RII, IGF-I, EGF, HGF, PDGF-AB, PDGF-BB, VEGF, TGF-?1, and sIL-1RII, Compositions may also contain white blood cells and platelets.
    Type: Grant
    Filed: March 15, 2013
    Date of Patent: December 4, 2018
    Inventors: Krista O'Shaughnessey, Jennifer E. Woodell-May, Joel C. Higgins, Michael D. Leach
  • Patent number: 10114021
    Abstract: The application discloses Quiescin Q6 as a new biomarker for acute heart failure. Methods for determining the quantity of Quiescin Q6 in a sample from a subject are described. The quantity of Quiescin Q6 is determined by contacting the sample with one or more binding agents capable of specifically binding to Quiescin Q6.
    Type: Grant
    Filed: August 19, 2016
    Date of Patent: October 30, 2018
    Assignee: MYCARTIS NV
    Inventor: Koen Kas
  • Patent number: 10088466
    Abstract: Methods and systems for measuring and using the oxidation-reduction potential (ORP) of a biological sample are provided. The system generally includes a test strip and a readout device for determining the ORP. The measured ORP is then used to determine characteristics relating to the fertility of the sample or the subject from which the sample was derived. Some characteristics that can be determined include the quality of a sperm sample, an oocyte or a fertilized egg. The measured ORP value can also be used to determine the specific characteristics of a spermatozoa sample, such as the morphology of the spermatozoa, the motility of the spermatozoa, the number of cells in the sample and the concentration of the cells in the sample. Knowledge of such characteristics and fertility potential can be used to identify individuals that might benefit from specific fertility treatments.
    Type: Grant
    Filed: March 22, 2017
    Date of Patent: October 2, 2018
    Assignee: Aytu BioScience, Inc.
    Inventors: Raphael Bar-Or, David Bar-Or, Leonard T. Rael, Kimberly B. Bjugstad, Ashok Agarwal, Rakesh Sharma, Sajal Gupta
  • Patent number: 10028902
    Abstract: Embodiments of the disclosure provide methods and/or compositions useful for an individual in need of treatment of a cardiac-related medical condition. In particular cases, GLP-1 is employed in a ultrasound targeted microbubble destruction (UTMD) system for delivery to cardiac tissue, thereby stimulating myocardial regeneration and, in at least some cases, reversal of cardiomyopathy.
    Type: Grant
    Filed: November 7, 2014
    Date of Patent: July 24, 2018
    Assignee: Baylor Research Institute
    Inventors: Paul A. Grayburn, Shuyuan Chen
  • Patent number: 9993555
    Abstract: The invention is a composition of human insulin or insulin analog that includes specific concentrations of citrate, chloride, in some cases including the addition of sodium chloride, zinc and, optionally, magnesium chloride and/or surfactant, and that has faster pharmacokinetic and/or pharmacodynamic action than commercial formulations of existing insulin analog products.
    Type: Grant
    Filed: December 9, 2015
    Date of Patent: June 12, 2018
    Assignee: Eli Lilly and Company
    Inventors: Michael Patrick Akers, Chi A. Nguyen, Chad D. Paavola, Virender Kumar Sarin, Nanette Elizabeth Schulte, Ranajoy Majumdar
  • Patent number: 9988428
    Abstract: Described herein are bioactive peptides that are modified at one or more positions with a PEG moiety. An example of such a PEGylated bioactive peptide is a GHRH analog that is modified at one or more positions with a PEG moiety. Also described are pharmaceutically acceptable salts thereof and pharmaceutical compositions comprising such analogs or salts thereof, as well as methods, kits and uses thereof, for example for inducing or stimulating growth hormone secretion in a subject and for diagnosing, preventing or treating GH-deficient conditions in a subject.
    Type: Grant
    Filed: April 18, 2017
    Date of Patent: June 5, 2018
    Assignee: GRIFFON PHARMACEUTICALS INC.
    Inventor: Krishna G. Peri
  • Patent number: 9968648
    Abstract: The invention relates to the use of a mixture of tetraethyleneglycol and amino sugars such as glucosamine or galactosamine to protect peptides and proteins and enhance their stability in solution.
    Type: Grant
    Filed: May 15, 2015
    Date of Patent: May 15, 2018
    Assignee: Calor ehf.
    Inventors: Sveinbjorn Gizurarson, Stefan Jon Sigurdsson
  • Patent number: 9901622
    Abstract: The present invention provides rapid-acting insulin and insulin analog formulations. The invention further provides delivery devices, particularly infusion sets, which allow for the rapid absorption of insulin and insulin analogs, as well as other active agents. Methods of using the insulin and insulin analog formulations as well as the insulin delivery devices for treating subjects with diabetes mellitus are also provided.
    Type: Grant
    Filed: January 13, 2015
    Date of Patent: February 27, 2018
    Assignee: THERMALIN DIABETES, INC.
    Inventors: Jeffrey I. Joseph, Richard William Berenson, Bruce Frank, Michael A. Weiss, Thomas Hattier, Gregory Dubé, Zhiqiang Chen
  • Patent number: 9889205
    Abstract: Insulin conjugates comprising an insulin molecule covalently attached to at least one bi-dentate linker having two arms, each arm independently attached to a ligand comprising a saccharide and wherein the saccharide for at least one ligand of the linker is fucose are disclosed. The insulin conjugates display a pharmacokinetic (PK) and/or pharmacodynamic (PD) profile that is responsive to the systemic concentrations of a saccharide such as glucose or alpha-methylmannose even when administered to a subject in need thereof in the absence of an exogenous multivalent saccharide-binding molecule such as Con A.
    Type: Grant
    Filed: June 24, 2016
    Date of Patent: February 13, 2018
    Assignee: Merck Sharp & Dohme Corp.
    Inventors: Songnian Lin, Lin Yan, Pei Huo
  • Patent number: 9861625
    Abstract: Provided herein are methods for treating cancer relating to inhibition of PI3K, as pharmaceutical compositions comprising a PI3K inhibitor and a PAK1 inhibitor.
    Type: Grant
    Filed: January 8, 2014
    Date of Patent: January 9, 2018
    Assignee: Duke University
    Inventors: Sandeep S. Dave, Katherine Walsh
  • Patent number: 9791461
    Abstract: An object of the present invention is to provide a novel examination method for a cardiovascular disease. As means for achieving the object, provided is an examination method for a cardiovascular disease, the method including the steps of: measuring a concentration of cyclophilin A protein in a human blood sample; and determining a probability of development of a cardiovascular disease based on the measured concentration of cyclophilin A protein.
    Type: Grant
    Filed: October 29, 2013
    Date of Patent: October 17, 2017
    Assignee: TOHOKU UNIVERSITY
    Inventors: Hiroaki Shimokawa, Kimio Satoh
  • Patent number: 9717689
    Abstract: Methods are provided for coating crystalline microparticles with an active agent by altering the surface properties of the microparticles in order to facilitate favorable association on the microparticle by the active agent. Types of surface properties that are altered by the disclosed methods include electrostatic properties, hydrophobic properties, and hydrogen bonding properties.
    Type: Grant
    Filed: February 5, 2016
    Date of Patent: August 1, 2017
    Assignee: MannKind Corporation
    Inventors: Keith A. Oberg, Joseph Sulner, Marshall L. Grant
  • Patent number: 9585942
    Abstract: The invention relates to an insulin analogue or its pharmaceutically acceptable salt, pharmaceutical composition with prolonged therapeutic effect, application of the insulin analogue, dosage method and method of treatment of diabetes. In more detail, the solution pertains to compounds being stable insulin analogues which are pharmaceutically active and characterized by a prolonged, flat, truly peakless course of glucose concentration vs. time during repeated administration and which do not show strong 24 hours fluctuations of glucose concentration, or the so-called “sawteeth effect”, during this time. Results of studies of compounds included in the scope of this application indicate an improvement in the effects of diabetes treatment by avoiding the hitherto occurring adverse influence of changes in glucose concentration throughout the entire day on a patient's organism, e.g.
    Type: Grant
    Filed: May 22, 2013
    Date of Patent: March 7, 2017
    Assignee: Instytut Biotechnologii i Antybiotykow
    Inventors: Piotr Borowicz, Andrzej Płucienniczak, Jerzy Mikołajczyk, Jarosław Antosik, Jacek Pstrzoch, Justyna Bernat, Diana Mikiewicz-Syguła, Monika Bogiel, Dorota Stadnik, Graźyna Płucienniczak, Boźena Tejchman-Małecka, Tadeusz Głąbski, Iwona Sokołowska, Dariusz Kurzynoga, Anna Wojtowicz-Krawiec, Marcin Zieliński, Malgorzata Kęsik-Brodacka, Natalia Łukasiewicz, Violetta Cecuda-Adamczewska, Monika Pawłowska, Tomasz Pawlukowiec, Jacek Stępniewski
  • Patent number: 9579287
    Abstract: A method of repairing tissue includes implanting into a patient a therapeutically effective amount of a pharmaceutical composition including microparticles including a biodegradable, biocompatible material having cells of interest or fragments thereof adhered to at least a portion of a surface; and at least one substance active on the cells or their environment upon implantation of the microparticles in a patient associated with the material wherein the substances is released in a controlled or extended manner.
    Type: Grant
    Filed: January 28, 2015
    Date of Patent: February 28, 2017
    Assignee: INSERM (INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE)
    Inventors: Claudia Montero-Menei, Philippe Menei, Jean-Pierre Benoit, Valérie Tatard, Marie-Claire Venier
  • Patent number: 9458218
    Abstract: The present invention provides therapeutic agents and compositions comprising elastic peptides and therapeutic proteins. Such peptides exhibit a flexible, extended conformation. In some embodiments, the therapeutic protein is a GLP-1 receptor agonist (e.g., GLP-1, exendin), insulin, or Factor VII/VIIa, including functional analogs. The present invention further provides encoding polynucleotides, as well as methods of making and using the therapeutic agents. The therapeutic agents have improvements in relation to their use as therapeutics, including, inter alia, one or more of half-life, clearance and/or persistance in the body, solubility, and bioavailability.
    Type: Grant
    Filed: March 4, 2014
    Date of Patent: October 4, 2016
    Assignee: DUKE UNIVERSITY
    Inventor: Ashutosh Chilkoti
  • Patent number: 9457063
    Abstract: Disclosed is a method for the prevention or treatment of vascular leakage-induced diseases and diabetic retinopathy, using C-peptide. Found to prevent extravacular leakage by inhibiting VEGF-induced disassembly of VE-cadherin, C-peptide can be applied to the prevention or treatment of various diabetic complications accompanied by vascular leakage.
    Type: Grant
    Filed: August 6, 2013
    Date of Patent: October 4, 2016
    Assignees: KANGWON NATIONAL UNIVERSITY UNIVERSITY-INDUSTRY COOPERATION FOUNDATION, AMOGREENTECH CO., LTD.
    Inventors: Kwon-Soo Ha, Young-Cheol Lim
  • Patent number: 9310379
    Abstract: This invention relates to crystals of whole antibodies and fragments thereof, and formulations and compositions comprising such crystals. More particularly, methods are provided for the crystallization of high concentrations of whole antibodies, and fragments thereof, in large batches, and for the preparation of stabilized whole antibody crystals for use alone, or in dry or slurry formulations or compositions. This invention also relates to methods for stabilization, storage and delivery of biologically active whole antibody crystals. The present invention further relates to methods using whole antibody crystals, antibody fragment crystals, or compositions or formulations comprising such crystals for biomedical applications, including biological delivery to humans and animals.
    Type: Grant
    Filed: September 25, 2008
    Date of Patent: April 12, 2016
    Assignee: Ajinomoto Althea, Inc.
    Inventors: Bhami Shenoy, Chandrika P. Govardhan, Mark X. Yang, Alexey L. Margolin
  • Patent number: 9283193
    Abstract: Methods are provided for coating crystalline microparticles with an active agent by altering the surface properties of the microparticles in order to facilitate favorable association on the microparticle by the active agent. Type of surface properties that are altered by the disclosed methods include by electrostatic properties, hydrophobic properties and hydrogen bonding properties.
    Type: Grant
    Filed: April 10, 2014
    Date of Patent: March 15, 2016
    Assignee: MannKind Corporation
    Inventors: Keith A. Oberg, Joseph Sulner, Marshall L. Grant
  • Patent number: 9238083
    Abstract: A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ?ID?NO.?1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2?(1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.
    Type: Grant
    Filed: September 29, 2010
    Date of Patent: January 19, 2016
    Assignees: Kyoto University, ARKRAY, Inc.
    Inventors: Hideo Saji, Nobuya Inagaki, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
  • Patent number: 9216207
    Abstract: A method for oral administration of an active ingredient to a subject is provided whereby a plurality of bubbles containing the active ingredient t are formed in a small intestinal of the subject. The method includes administering orally to the subject an effective amount of the above-mentioned pharmaceutical composition. The pharmaceutical composition includes a drug layer and an enteric coating layer. The drug layer comprises an active ingredient, a surfactant, an acidic component and an effervescent ingredient. The active ingredient comprises a nucleic acid, a peptide or a protein. When the acidic component of the drug layer is dissolved in the small intestinal to react with the effervescent ingredient for generating carbon dioxide and the plurality of bubbles containing the active ingredient, and the active ingredient is embedded in a gap formed between an inner layer and an outer layer of an double-layer structure formed by the surfactant.
    Type: Grant
    Filed: October 14, 2014
    Date of Patent: December 22, 2015
    Assignee: NATIONAL TSING HUA UNIVERSITY
    Inventors: Hsing-Wen Sung, Er-Yuan Chuang, Po-Yen Lin
  • Patent number: 9119816
    Abstract: Disclosed are a method and composition for the prevention or treatment of diabetic angiogenesis impairment or diabetic wound-healing impairment, using C-peptide. Found to be able to induce angiogenesis through chemotactic migration of endothelial cells, cell migration to wounded areas, capillary-like network formation, and extracellular signal-regulated kinases 1/2 and Akt phosphorylation and nitric oxide production, C-peptide has prophylactic or therapeutic applications in a broad spectrum of various diabetic complications including diabetic angiogenesis impairment.
    Type: Grant
    Filed: August 6, 2013
    Date of Patent: September 1, 2015
    Assignee: AMOGREENTECH CO., LTD.
    Inventors: Kwon-Soo Ha, Young-Cheol Lim
  • Patent number: 9084831
    Abstract: A precursor of a molecular probe for imaging of pancreatic islets is provided.
    Type: Grant
    Filed: March 17, 2011
    Date of Patent: July 21, 2015
    Assignees: Kyoto University, ARKRAY, Inc.
    Inventors: Nobuya Inagaki, Hideo Saji, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa
  • Patent number: 9068013
    Abstract: In one aspect, the disclosure provides cross-linked materials that include multivalent lectins with at least two binding sites for glucose, wherein the lectins include at least one affinity ligand which is capable of competing with glucose for binding with at least one of said binding sites and is covalently linked to a cysteine residue of the lectins; and conjugates that include two or more separate affinity ligands bound to a conjugate framework, wherein the two or more affinity ligands compete with glucose for binding with the lectins at said binding sites and wherein conjugates are cross-linked within the material as a result of non-covalent interactions between lectins and affinity ligands on different conjugates. These materials are designed to release amounts of conjugate in response to desired concentrations of glucose. Depending on the end application, in various embodiments, the conjugates may also include a drug and/or a detectable label.
    Type: Grant
    Filed: July 22, 2011
    Date of Patent: June 30, 2015
    Assignee: SMART CELLS, INC.
    Inventors: Thomas M. Lancaster, Robert Butters, Naomi Choodnovskiy, Todd C. Zion
  • Patent number: 9045560
    Abstract: Novel acylated insulin analogues exhibiting resistance towards proteases can, effectively, be administered pulmonary or orally. The insulin analogues contain B25H and A14E or A14H.
    Type: Grant
    Filed: August 22, 2013
    Date of Patent: June 2, 2015
    Assignee: NOVO NORDISK A/S
    Inventors: Peter Madsen, Thomas Boerglum Kjeldsen, Thomas Hoeg-Jensen, Palle Jakobsen, Tina Moeller Tagmose, Tine Glendorf, Jaanos Tibor Kodra, Patrick William Garibay, Jacob Sten Petersen
  • Publication number: 20150147399
    Abstract: The present invention provides a pharmaceutical composition formulated for oral delivery, comprising a particulate non-covalently associated mixture of pharmacologically inert silica nanoparticles having a hydrophobic surface, a polysaccharide, and a biologically active protein or peptide suspended in an oil. The present invention further provides methods of manufacturing same and therapeutic methods utilizing same for oral delivery of a therapeutic protein or peptide.
    Type: Application
    Filed: December 9, 2014
    Publication date: May 28, 2015
    Inventors: Alexander Vol, Orna Gribova
  • Publication number: 20150147345
    Abstract: This document relates to conjugates of a biologically active molecule or a derivative thereof and functionalized (e.g., mono- or bi-functional) polymers (e.g., polyethylene glycol and related polymers) as well as methods and materials for making and using such conjugates.
    Type: Application
    Filed: June 12, 2013
    Publication date: May 28, 2015
    Inventor: Marek Kwiatkowski
  • Publication number: 20150141328
    Abstract: Disclosed herein are systems and methods for stimulating meibomian gland epithelial cell function by administering to the ocular surface or immediate vicinity of an eye of a subject an effective amount of a pharmaceutical composition containing a PLD-inducing compound, such as the cationic amphiphilic drugs (e.g. azithromycin), androgen or an androgen analogue with androgen effectiveness, corticosteroid, progesterone, IGF-1 or an IGF-1 analogue (e.g. insulin), GH, and mixtures thereof. The pharmaceutical compositions are effective to treat a variety of aliments to the eye including meibomian gland dysfunction, evaporative dry eye disease, lipid abnormalities in meibum or the tear film, and autoimmune diseases such as Sjögren's syndrome.
    Type: Application
    Filed: November 18, 2014
    Publication date: May 21, 2015
    Inventors: David A. Sullivan, Juan Ding, Yang Liu, Wendy Kam
  • Publication number: 20150140093
    Abstract: Compositions, methods of making, and methods of using nanoclusters in which the nanoclusters comprise a plurality of nanoparticles having a core of nanoparticles arranged such that the surfaces of the nanoparticles contact adjacent nanoparticles, the nanoparticles comprise an active ingredient, and the nanocluster has a mass median aerodynamic diameter of from about 0.25 ?m to about 20 ?m.
    Type: Application
    Filed: November 6, 2014
    Publication date: May 21, 2015
    Inventors: Cory J. Berkland, Lianjun Shi, Nashwa El Gendy, Carl Plumley, Mark Bailey
  • Patent number: 9034818
    Abstract: The invention concerns a soluble pharmaceutical formulation comprising an insulin derivative wherein the formulation further comprises more than 4 zinc atoms per 6 molecules of the insulin derivative, and a citric acid monohydrate and/or a histidine compound used in an amount sufficient to increase the tendency of the insulin derivative to self-associate into dodecamers. The invention further comprises a process for preparing the soluble pharmaceutical formulation.
    Type: Grant
    Filed: June 12, 2008
    Date of Patent: May 19, 2015
    Assignee: Novo Nordisk A/S
    Inventors: Christian Poulsen, Kasper Huus, Frantisek Hubalek, Dorte Bjerre Steensgaard, Svend Havelund
  • Patent number: 9034323
    Abstract: Provided are methods for control of post-prandial glucose in diabetic subjects by administering a fast-acting insulin analog and a hyaluronidase degrading enzyme. The fast-acting insulin analog and a hyaluronidase are administered between 15 minutes before the meal and 30 minutes after commencing the meal.
    Type: Grant
    Filed: September 24, 2013
    Date of Patent: May 19, 2015
    Assignee: Halozyme, Inc.
    Inventors: Gregory I. Frost, Igor Bilinsky, Daniel Vaughn, Barry Sugarman
  • Publication number: 20150126442
    Abstract: A stable pharmaceutical formulation containing an insulin derivative can conveniently be prepared by adding glycerol, phenol, m-cresol and zinc ions to it.
    Type: Application
    Filed: April 5, 2013
    Publication date: May 7, 2015
    Applicant: NOVO NORDISK A/S
    Inventors: Helle Naver, Morten Schlein, Dorte Bjerre Steensgaard, Ingrid Vivika Petterson
  • Publication number: 20150125518
    Abstract: The present invention is embodied by a composition capable of chaperoning a typically non-orally available therapeutic or diagnostic agent through the environment of the digestive tract such that the therapeutic or diagnostic agent is bioavailable. The composition may or may not be targeted to specific cellular receptors, such as hepatocytes. Therapeutic agents include, but are not limited to, insulin, calcitonin, serotonin, and other proteins. Targeting is accomplished with biotin or metal based targeting agents.
    Type: Application
    Filed: January 8, 2015
    Publication date: May 7, 2015
    Inventors: JOHN R. LAU, W. BLAIR GEHO
  • Publication number: 20150118280
    Abstract: The present invention relates to means for protecting bioactive materials in mammalian food or feed formulations used to enhance the health status of mammals.
    Type: Application
    Filed: November 3, 2014
    Publication date: April 30, 2015
    Inventors: Amir Barzilay, Hagit Koren-Lichtig
  • Publication number: 20150118185
    Abstract: Compositions containing conjugates of heparosan polymer with at least one drug are disclosed, along with methods of production and use thereof.
    Type: Application
    Filed: November 7, 2014
    Publication date: April 30, 2015
    Inventor: Paul L. DeAngelis
  • Patent number: 9018161
    Abstract: The present invention relates to novel insulin analogues exhibiting resistance towards protease, wherein at least two amino acids are substituted and/or deleted relative to the parent insulin molecule. A method for the preparation of such insulin analogues, insulin preparations containing the insulin analogues of the invention and a method of treating diabetes mellitus using these insulin analogues is also provided.
    Type: Grant
    Filed: September 20, 2007
    Date of Patent: April 28, 2015
    Assignee: Novo Nordisk A/S
    Inventors: Peter Kresten Nielsen, Frantisek Hubalek, Inger Lautrup-Larsen, Svend Ludvigsen, Ulla Ribel-Madsen, Per Balschmidt, Per Nørgaard, Svend Havelund
  • Publication number: 20150112302
    Abstract: Methods and devices are provided for reducing a diabetic patient's foreign body immune response, including infusion site-loss and/or occlusion. Such foreign body responses are associated with the treatment of the diabetic patient where the treatment requires subcutaneous implantation of a foreign body, such as a cannula or catheter. In certain embodiments of the invention, a response-inhibiting agent is administered to a patient at the site of cannula/catheter insertion, thereby facilitating delivery of insulin to the diabetic patient and mitigating site-loss and/or occlusion over a period of time.
    Type: Application
    Filed: October 13, 2014
    Publication date: April 23, 2015
    Inventors: Sarnath Chattaraj, Kiem H. Dang, Hsi Chung Fusselman, Poonam S. Gulati, Lance P. Hoffman, Guangping Zhang
  • Patent number: 9011309
    Abstract: An electromagnetic radiation activated device comprises a property changing material and at least one functionalized fullerene that upon irradiation of the functionalized fullerenes with electromagnetic radiation of one or more frequencies a thermally activated chemical or physical transformation occurs in the property changing material. The thermal activated transformation of the property changing material is triggered by the heating or combustion of the functionalized fullerenes upon their irradiation. The device can include a chemical agent that is embedded in the property changing material and is released when the material is heated by the functionalized fullerenes upon irradiation.
    Type: Grant
    Filed: May 12, 2011
    Date of Patent: April 21, 2015
    Assignee: University of Florida Research Foundation, Inc.
    Inventors: Vijay Krishna, Karl Zawoy, Brij M. Moudgil, Benjamin L. Koopman, Nathanael Ian Stevens, Kevin William Powers
  • Publication number: 20150104515
    Abstract: The invention generally relates to a method for pulmonary delivery of therapeutic, prophylactic and diagnostic agents to a patient wherein the agent is released in a sustained fashion, and to particles suitable for use in the method. In particular, the invention relates to a method for the pulmonary delivery of a therapeutic, prophylactic or diagnostic agent comprising administering to the respiratory tract of a patient in need of treatment, prophylaxis or diagnosis an effective amount of particles comprising a therapeutic, prophylactic or diagnostic agent or any combination thereof in association with a charged lipid, wherein the charged lipid has an overall net charge which is opposite to that of the agent upon association with the agent. Release of the agent from the administered particles occurs in a sustained fashion.
    Type: Application
    Filed: May 15, 2014
    Publication date: April 16, 2015
    Applicant: Massachusetts Institute of Technology
    Inventors: David A. Edwards, Robert S. Langer, Rita Vanbever, Jeffrey D. Mintzes, Jue Wang, Donghao Chen
  • Publication number: 20150105317
    Abstract: Insulin conjugates comprising an insulin molecule covalently attached to at least one bi-dentate linker having two arms, each arm independently attached to a ligand comprising a saccharide and wherein the saccharide for at least one ligand of the linker is fucose are disclosed. The insulin conjugates display a pharmacokinetic (PK) and/or pharmacodynamic (PD) profile that is responsive to the systemic concentrations of a saccharide such as glucose or alpha-methylmannose even when administered to a subject in need thereof in the absence of an exogenous multivalent saccharide-binding molecule such as Con A.
    Type: Application
    Filed: October 2, 2014
    Publication date: April 16, 2015
    Inventors: Songnian Lin, Lin Yan, Ahmet Kekec, Yuping Zhu, David N. Hunter, Pei Huo, Danqing Feng, Ravi P. Nargund, Christopher R. Moyes, Zhiqiang Zhao, Brenda Pipik, Dmitri Pissarnitski, Joseph L. Duffy, Erin N. Guidry
  • Patent number: 9005637
    Abstract: Compositions and methods for combination therapy are provided. The compositions comprise a multiple unit dosage form having both a therapeutic agent and a nutritional supplement. The combination therapy is useful for restoring a nutrient depletion associated with a particular disease state. Additionally, the combination therapy can prevent or attenuate the depletion of a nutrient caused, in whole or in part, by the co-administrated therapeutic drug. Methods of manufacturing the formulations are likewise described.
    Type: Grant
    Filed: April 5, 2013
    Date of Patent: April 14, 2015
    Assignee: JDS Therapeutics, LLC
    Inventor: James R Komorowski