Mouthwash Patents (Class 514/901)
-
Patent number: 8961939Abstract: Disclosed are compositions, apparatus, and related methods and systems for oral health care.Type: GrantFiled: February 24, 2012Date of Patent: February 24, 2015Assignee: NowSystem, Inc.Inventors: Janice Lou King, Dale Leland Winetroub
-
Patent number: 8945596Abstract: The present invention relates to an antimicrobial composition. It particularly relates to an antimicrobial composition for cleansing or personal care. It is an object of the present invention to provide antimicrobial compositions that have relatively fast antimicrobial action. Present inventors have surprisingly found that compositions comprising selected ingredients, namely thymol and terpineol, in selective proportions provide relatively quick antimicrobial action.Type: GrantFiled: October 8, 2009Date of Patent: February 3, 2015Assignee: Conopco, Inc.Inventors: Amit Chakrabortty, Srilaxmi Venkata Medepalli
-
Patent number: 8926949Abstract: The present invention provides compositions and related methods for oral health treatment of a subject. Compositions of the invention include an anti-oxidant enzyme, an anti-inflammatory agent, and a pharmaceutically acceptable buffer. In certain embodiments, the compositions are administered to the subjection in conjunction with teeth whitening, oral surgery, oral pathology treatment, endodontic therapy, periodontal therapy, dental restoration, preventative tooth cleaning, or subsequent to a pro-oxidant.Type: GrantFiled: April 29, 2011Date of Patent: January 6, 2015Inventor: Rebecca Dayanim
-
Patent number: 8795638Abstract: This invention pertains to dental care compositions with antimicrobial benefits. In particular, the invention provides for compositions of oral tissue-adherent salts that release biocidal ions on a controlled release basis and thereby provide and maintain an essentially uniform concentration of biocidal ions above the MBC or MIC of the target bacteria at the site of application in the mouth for an extended period of time. The compositions are useful for treating or preventing oral diseases resulting from bacteria, fungal or yeast infections, such as caries, gingivitis, periodontal disease and candidiasis.Type: GrantFiled: October 6, 2011Date of Patent: August 5, 2014Assignee: Nevada Naturals Inc.Inventors: Anthony Errol Winston, Richard F. Stockel, Anthony Joseph Sawyer
-
Patent number: 8652444Abstract: Antiplaque oral compositions are provided that contain an orally acceptable carrier and an antibacterial effective amount of the compound of formula (I). In various embodiments, the compositions contain from about 0.001% to about 10% by weight of the compound of formula (I).Type: GrantFiled: November 9, 2011Date of Patent: February 18, 2014Assignee: Colgate-Palmolive CompanyInventors: Ravi Subramanyam, Prem Sreenivasan
-
Patent number: 8496914Abstract: The present invention provides an antibacterial oral rinse formulation having enhanced antibacterial activity against oral bacteria associated with infectious and inflammatory processes for preventing and/or treating inflammatory diseases or inflammatory processes associated with diseases in an individual by inhibiting the transient bacteremia associated with oral hygiene activities by the individual. Also provided is a method for preventing and/or treating inflammatory diseases or inflammatory processes associated with diseases in an individual by inhibiting transient bacteremia associated with oral hygiene activities by the individual, comprising rinsing with the antibacterial oral rinse formulation for a period of time immediately prior to engaging in oral hygiene activities.Type: GrantFiled: December 13, 2006Date of Patent: July 30, 2013Inventor: Richard Paul Bonfiglio
-
Patent number: 8377424Abstract: This invention relates to a method of therapeutic or prophylactic treatment of periodontal disease comprising administering to a subject in need thereof a polymeric compound of formula An. Also disclosed and claimed is an article of manufacture comprising the above compounds packaged within a container with instructions for use, and methods of making thereof.Type: GrantFiled: December 3, 2004Date of Patent: February 19, 2013Assignee: Mars, IncorporatedInventors: Leo J. Romanczyk, Jr., Harold H. Schmitz
-
Patent number: 8343483Abstract: New strains of Lactobacillus that have been selected for their capability of improved reduction the number of Streptococcus mutans in the mouth of mammals through inhibiting activity in combination with better binding to the oral mucins and dental plaque, thereby preventing, reducing or treating dental caries, and products derived from said strains, including agents for treatment or prophylaxis of caries for administration to humans.Type: GrantFiled: October 15, 2008Date of Patent: January 1, 2013Assignee: Biogaia ABInventors: Bo Mollstam, Eamonn Connolly
-
Patent number: 8075924Abstract: A method of treating or ameliorating an indication of mucosal or adjacent tissue comprising periodically applying to mucosa at or adjacent to disease affected tissue a rinse comprising: an effective amount of appropriate composition of herbal bioactive comprising active(s) of one or more of Sambucus nigra, Centella asiatica or Echinacea purpurea; an antimicrobially effective amount of a quaternary ammonium surfactant; and optionally a polymer or mixture of polymers effective to coat said tissue and entrap said extract(s).Type: GrantFiled: July 20, 2007Date of Patent: December 13, 2011Assignee: IZUN Pharmaceuticals CorporationInventors: Zvi G. Loewy, William Zev Levine, Aron J. Saffer
-
Patent number: 7850996Abstract: The use of selenite- or selenate-containing preparations supplemented with pharmaceutically acceptable or food-compatible acids for the preparation of an agent intended for topical or buccal application or mucosal administration is described.Type: GrantFiled: December 4, 2002Date of Patent: December 14, 2010Assignee: Vis-Vitalis Lizenz-Und Handels AGInventors: Peter Kössler, Norbert Fuchs, Bodo Kuklinski
-
Patent number: 7846422Abstract: The present invention relates to a method for prevention or treatment of periodontal diseases, containing administering lignans represented by the following formula (1) (wherein R1 represents a hydrogen atom or a hydroxyl group; R2, R3, R4 and R5 are the same or different and each represents a hydrogen atom, a hydroxyl group, a C1-10 alkyl group, a hydroxy C1-10 alkyl group or a C1-10 alkoxy group) or plant extracts containing the lignans.Type: GrantFiled: August 3, 2004Date of Patent: December 7, 2010Assignee: Kao CorporationInventors: Kazushi Oshino, Ikuhisa Ichimura, Hisataka Kobayashi, Minoru Takizawa, Hidetake Fujinaka
-
Patent number: 7700077Abstract: The invention concerns the use for treating and cleaning the eye and its appendages of aqueous ionic solutions obtained from sea water whereof the ionic composition is qualitatively that of sea water and quantitatively such that their pH ranges between 4 and 9, preferably between 7 and 8 and their osmolality ranges between 150 and 700, preferably between 250 and 350 mOsm/kg.Type: GrantFiled: May 23, 2005Date of Patent: April 20, 2010Assignee: Laboratories de la MerInventors: Jean-Claude Yvin, Benedicte Marie Dominique Halley, Didier Leroy
-
Patent number: 7547433Abstract: Stable, viscous, mucoadhesive aqueous compositions which are useful for the prevention and treatment of ulcerative, inflammatory, and/or erosive disorders of mucous membranes and/or the delivery of pharmaceutically active compounds to mucosal surfaces for topical treatment or transfer to the systemic circulation.Type: GrantFiled: February 15, 2002Date of Patent: June 16, 2009Assignee: Access Pharmaceuticals, Inc.Inventors: Jeremy E. Jacob, David P. Nowotnik, Christiane M. Baud
-
Patent number: 7544348Abstract: Stable, viscous, mucoadhesive aqueous compositions which are useful for the prevention and treatment of ulcerative, inflammatory, and/or erosive disorders of mucous membranes, especially mucositis.Type: GrantFiled: August 15, 2002Date of Patent: June 9, 2009Assignee: Access Pharmaceuticals, Inc.Inventors: Jeremy E. Jacob, David P. Nowotnik, Christiane M. Baud
-
Patent number: 7498021Abstract: Dental products such as toothpastes, mouthwash and dental floss are disclosed which products are enhanced by having dissolved, dispersed or coated thereon a compound which promoted bone growth. Preferred compounds are peptide sequences comprising 10 to 50 amino acids are disclosed. The sequences are characterized by containing an integrin binding motif such as RGD sequence and the remainder of amino acids contiguous with the RGD sequence in matrix extracellular phosphoglycoprotein. The sequences may be formulated for dispersed in toothpaste or a mouthwash and administered to enhance bone/tooth growth. When the dental products are used repeatedly over time they enhance good dental health.Type: GrantFiled: April 19, 2006Date of Patent: March 3, 2009Assignee: Acologix, Inc.Inventors: Toshiyuki Yoneda, Motoyoshi Nomizu, Yoshinari Kumagai, Russell Wayne Blacher
-
Patent number: 7470437Abstract: Methods of treating conditions with a metal-containing material are disclosed. The metal-containing material can be, for example, an antimicrobial material, an antibacterial material, an anti-inflammatory material, an anti-fungal material, an anti-viral material, an anti-cancer material, a pro-apoptosis material, and/or an MMP modulating material. In certain embodiments, the metal-containing material is an atomically disordered, silver-containing material.Type: GrantFiled: November 10, 2004Date of Patent: December 30, 2008Assignee: Nucryst Pharmaceuticals Corp.Inventors: Robert E. Burrell, John B. Wright, Kan Lam, Antony G. Naylor, Peter H. Moxham, Scott H. Gillis, Paul Schechter
-
Patent number: 7300645Abstract: Disclosed is an oral composition comprising palatinit. More particularly, disclosed is an oral composition comprising palatinit which exerts a synergistic effect when combined with a fluorine or zinc compound.Type: GrantFiled: October 24, 2002Date of Patent: November 27, 2007Assignee: Sunstar Kabushiki KaishaInventors: Tsutomu Takatsuka, Akira Nakao
-
Patent number: 7279151Abstract: This invention relates to novel dental compositions and methods for preventing dental plaque and caries formation and generally for inhibiting tooth decay and brightening/whitening teeth. The compositions of this invention comprise herbs such as Citrus karna raf., Zanthoxylum armatum D.C. and Azadirachta indica A. Juss. thereof which can be combined with pharmaceutically acceptable carriers or diluents to be administered in the form of conventional dental compositions. The compositions of the present invention, also preferably, contain Mint.Type: GrantFiled: March 25, 2004Date of Patent: October 9, 2007Assignee: Council of Scientific and Industrial ResearchInventors: Palpu Pushpangadan, Chandana Venkateswara Rao, Sanjeev Kumar Ojha, Kuttan Pillai Narayanan Nair, Madan Mohan Pandey, Ajay Kumar Singh Rawat, Shanta Mehrotra
-
Patent number: 7276229Abstract: The use of viscosity modifying polymer materials, commonly used as stabilisers, thickeners and emulsifiers, as tooth erosion inhibitors in acidic compositions for oral administration, especially in acidic beverages such as fruit drinks and oral healthcare products such as mouthwashes, in which the effective pH of the composition is less than or equal to 4.5.Type: GrantFiled: August 31, 1999Date of Patent: October 2, 2007Assignee: SmithKline Beecham p.l.c.Inventors: Nicola Jane Baker, David Myatt Parker
-
Patent number: 7238342Abstract: Methods and solutions are provided for removal of the smear layer on prepared tooth and bone surfaces, especially in endodontic environments.Type: GrantFiled: January 21, 2003Date of Patent: July 3, 2007Assignee: Dentsply InternationalInventors: Mahmoud Torabinejad, William B. Johnson
-
Patent number: 7220404Abstract: An oral care composition having enhanced oral hygiene and antiplaque properties which comprises an orally acceptable vehicle containing a combination of an enzyme, cetylpyridinium chloride and a reducing agent.Type: GrantFiled: December 22, 2003Date of Patent: May 22, 2007Assignee: Colgate-Palmolive CompanyInventors: André M. Morgan, Lori H. Szeles, Malcolm Williams, Susan M. Herles, Chanda L. Macias, Robert D'Ambrogio, Thomas J. Boyd, James G. Masters
-
Patent number: 7195753Abstract: A non-foaming periodontic composition for treating gum diseases or used in bleaching teeth which are alcohol free. The composition is a mixture of an isoalkyl amine oxide and an antimicrobial betaine compound. The composition is useful for treating gum disease and whitening teeth.Type: GrantFiled: December 15, 2003Date of Patent: March 27, 2007Assignee: OraTecInventors: David M. Hall, James R. Hunt
-
Patent number: 7192572Abstract: A composition comprising (a) from 0.005% to 0.5% by weight of a cooling compound; (b) from 0.1% to 10% by weight of an emulsifiable substance; (c) from 0.15% to 15% by weight of a surfactant; (d) optionally up to 5% by weight, preferably from 0.05% to 5% by weight of a cosurfactant.Type: GrantFiled: December 18, 2003Date of Patent: March 20, 2007Assignee: Conopco, Inc.Inventors: Ingrid Anne Marie Appelqvist, Mark Emmett Malone, Asish Nandi
-
Patent number: 7105577Abstract: The present invention relates to the use of hydroxydiphenyl ether compounds as antimicrobially active substances, to certain new compounds of this type and to processes for the preparation of these compounds.Type: GrantFiled: April 2, 2004Date of Patent: September 12, 2006Assignee: Ciba Specialty Chemicals CorporationInventors: Werner Hölzl, Wolfgang Haap, Dietmar Ochs, Karin Puchtler, Marcel Schnyder, Surendra Umesh Kulkarni, Arakali Srinivasarao Radhakrishna, Mangesh Shivram Sawant, Asawari Bhikaji Mahtre
-
Patent number: 7101535Abstract: Disclosed is an oral composition effective against halitosis comprising an extract from Moutan (Paeonia suffruticosa Andrews) bark as an active ingredient, which is capable of inhibiting and eliminating substances causing oral malodor. The oral composition of the invention compromises an extract from Moutan bark, a medicinal herb, as an active ingredient, formulated in conjunction with to a conventional oral composition, thereby providing long lasting and powerful eliminating and preventive effects against halitosis.Type: GrantFiled: December 18, 2001Date of Patent: September 5, 2006Assignee: LG Household & Health Care Ltd.Inventors: Sang-Ki Park, Sang-Nyun Kim, Hyoung-Kook Park, Moon-Moo Kim
-
Patent number: 7087249Abstract: The invention relates to the use of one or more antimicrobial metals preferably selected from silver, gold, platinum, and palladium but most preferably silver, formed with atomic disorder, and preferably in a nanocrystalline form, for reducing inflammation or infection of the mucosal membrane. The antimicrobial metal may be formulated as, or used in the form of, a nanocrystalline coating of one or more antimicrobial or noble metals, a nanocrystalline powder of one or more antimicrobial or noble metals, or a liquid or solution containing dissolved species from a nanocrystalline powder or coating of one or more antimicrobial or noble metals.Type: GrantFiled: April 23, 2002Date of Patent: August 8, 2006Assignee: Nucryst Pharmaceuticals Corp.Inventors: Robert Edward Burrell, Antony George Naylor, Peter Howard Moxham
-
Patent number: 7078021Abstract: Dental products such as toothpastes, mouthwash and dental floss are disclosed which products are enhanced by having dissolved, dispersed or coated thereon a compound which promoted bone growth. Preferred compounds are peptide sequences comprising 10 to 50 amino acids are disclosed. The sequences are characterized by containing an integrin binding motif such as RGD sequence and the remainder of amino acids contiguous with the RGD sequence in matrix extracellular phosphoglycoprotein. The sequences may be formulated for dispersed in toothpaste or a mouthwash and administered to enhance bone/tooth growth. When the dental products are used repeatedly over time they enhance good dental health.Type: GrantFiled: August 9, 2001Date of Patent: July 18, 2006Assignee: Acologix, Inc.Inventors: Toshiyuki Yoneda, Motoyoshi Nomizu, Yoshinari Kumagai
-
Patent number: 7048910Abstract: The invention relates to the use of one or more compounds selected from compounds of formulae Ia and Ib, the physiologically compatible salts of compounds of formula Ia and Ib and the stereoisomer forms of compounds of formula La and Ib, wherein R1, R2, R3, R4 and n have the meaning cited in claim 1.Type: GrantFiled: August 8, 2001Date of Patent: May 23, 2006Assignee: Merck Patent GmbHInventors: Joachim Buenger, Hansjuergen Driller, Olaf den Hollander
-
Patent number: 6984667Abstract: Compositions with synergistic anti-inflammatory effect in inflammatory diseases resulting from activation and consequent degranulation of mast cell and followed by secretion of inflammatory biomolecules from the activated mast cells, composed of a heavily sulfated, non-bovine proteoglycan such as chondroitin sulfate C and one or more of a hexosamine sulfate such as D-glucosamine sulfate, a flavone such as quercetin, a special organic extra virgin kernel seed olive oil, S-adenosylmethionine and diphenhydramine.Type: GrantFiled: January 30, 2001Date of Patent: January 10, 2006Assignee: Theta Biomedical Consulting and Development Co.Inventor: Theoharis C. Theoharides
-
Patent number: 6919070Abstract: A stomatic composition has particles of hydroxyapatite with an average particle size in length (l), width (d) and thickness (h) of: l from 0.2 ?m to about 0.01 ?m, d from about 0.1 ?m to about 0.001 ?m and h from about 0.1 ?m to about 0.001 ?m.Type: GrantFiled: October 17, 1997Date of Patent: July 19, 2005Assignee: Zakrytoe Aktsionernoe Obschestvo “OSTIM”Inventors: Vsevolod Nikolaevich Rudin, Vladislav Petrovich Zuev, Vladimir Fedorovich Komarov, Igor Vitallevich Melikhov, Vladimir Vasillevich Minaev, Andrei Yurlevich Orlov, Anatoly Aleksandrovich Mishin, Viktor Evgenievich Bozhevolnov
-
Patent number: 6683067Abstract: Mucositis is treated and/or prevented by administrating to a patient a formulation comprising a tetracycline that is poorly absorbed from the gastro-intestinal tract. The tetracycline may be in the form of a pharmaceutically acceptable salt or a base. The formulations may optionally also contain an antifungal agent to prevent fungal overgrowth due to reduction in the normal oral flora by the tetracycline. Such compositions have the advantage of treating the entire gastro-intestinal tract since the active ingredient is not removed from the tract via absorption. Further, such compositions minimize systemic exposure and accompanying side effects.Type: GrantFiled: March 23, 2001Date of Patent: January 27, 2004Assignee: OraPharma, Inc.Inventors: James Ronald Lawter, Stephen J. Comiskey
-
Patent number: 6669931Abstract: A method of treating dental carries and remineralizing lesions includes the steps of directing a stream of oxidizing gas onto a carious lesions for a period of time sufficient to kill microorganisms within the carious lesion; and thereafter applying to the lesion a remineralization formulation.Type: GrantFiled: March 13, 2002Date of Patent: December 30, 2003Assignee: Curozone Ireland LimitedInventors: Edward Lynch, Jurgen Schemmer
-
Patent number: 6649148Abstract: A reductant rinse including xylitol prevents buildup in ozone carrying lines in apparatus for the treatment of dental caries.Type: GrantFiled: March 12, 2002Date of Patent: November 18, 2003Assignee: Curozone Ireland LimitedInventors: Edward Lynch, Jurgen Schemmer
-
Patent number: 6607711Abstract: A mouth hygienic composition effective in treating halitosis. The composition comprises a chelate comprising a metal ion, preferably a zinc ion, and an amino acid, preferably glycine.Type: GrantFiled: December 30, 1999Date of Patent: August 19, 2003Inventor: Ejvind Jersie Pedersen
-
Patent number: 6565895Abstract: The invention relates to the unexpected discovery that bismuth-containing compounds are effective in the treatment of oral mucositis in a mammal. Thus, the invention relates, in one aspect to a method of treating oral mucositis comprising administering an effective amount of a pharmaceutically acceptable bismuth-containing compound, such as a bismuth salt or bismuth complex. In a preferred embodiment, the bismuth compound is an organic or inorganic salt such as, bismuth subsalicylate, bismuth subgallate, bismuth aluminate, bismuth citrate, bismuth subcitrate, bismuth carbonate, bismuth subcarbonate, tripotassium dicitrato bismuthate, bismuth nitrate, bismuth subnitrate, bismuth tartrate and mixtures thereof, preferably, bismuth subsalicylate and bismuth subgallate.Type: GrantFiled: June 8, 2001Date of Patent: May 20, 2003Assignee: GelTex Pharmaceuticals, Inc.Inventors: Philip J. Goddard, Jeffrey D. Klinger, Pradeep K. Dhal, W. Harry Mandeville, III, Richard J. Fitzpatrick, Thomas X. Neenan
-
Patent number: 6544498Abstract: A periodontal disease preventive and ameliorative agent with milk-derived basic protein as its effective ingredient, which protein is obtained by contacting a milk or milk-derived ingredient with cation-exchange resin, and then eluting a fraction adsorbed by the resin using an elution solution and which protein has an isoelectric point within a range of 7.5˜11, and food/drink and a medicament such as toothpaste and gargling agents, which contain this periodontal disease preventive and ameliorative agent.Type: GrantFiled: March 20, 2000Date of Patent: April 8, 2003Assignee: Snow Brand Milk Products Co., Ltd.Inventors: Yukihiro Takada, Seiichirou Aoe, Atsusi Serizawa, Toshiaki Suguri, Shunichi Dousako
-
Patent number: 6528038Abstract: The present invention provides a composition for use in raising an immune response directed against Porphyromonas gingivalis. The composition includes a suitable adjuvant and/or acceptable carrier and one substantially purified P. gingivalis immunogen. The immunogen is selected from the group consisting of Antigen 1, Antigen 2, Antigen 3, Antigen 4 and epitope containing fragments thereof, in which: Antigen 1 is an antigen of P. gingivalis and has an internal amino acid sequence:DLENKGEATLLVTFGSSYKAPRETYAKIEKTFAAAYPDQR; Antigen 2 is an antigen of P. gingivalis and has an internal amino acid sequence: DNPDENPLEGDITQTHTEKYVLAED; Antigen 3 is an antigen of P. gingivalis and has an internal amino acid sequence: DVLLLDVTPLSLGIETMGGVMTYLIDANTTIPKLK; Antigen 4 is an antigen of P. gingivalis and has an internal amino acid sequence: VYNASISAVGNTSAIDPVVQIIHHN.Type: GrantFiled: July 7, 1998Date of Patent: March 4, 2003Assignee: The University of MelbourneInventors: Eric Charles Reynolds, Nada Slakeski, Anne Hendtlass
-
Patent number: 6426085Abstract: This invention provides for a method for treatment of corneal and dermal wounds by administering bismuth compounds in topical dosage forms. Bismuth compounds cause stimulation of release of growth factors in damaged tissue to promote regeneration of epithelial cells and hence accelerate wound healing. These bismuth compounds also have good antimicrobial activity against several anaerobic bacteria involved in diaper rash exacerbation.Type: GrantFiled: May 24, 2000Date of Patent: July 30, 2002Assignee: Josman Laboratories Inc.Inventor: Narayan K. Athanikar
-
Patent number: 6423300Abstract: The present invention relates to an oral composition containing a zinc compound containing free available zinc ion and at least one stabilized or stable Eh raising compound distributed in an oral vehicle. The present invention further relates to a method of inhibiting the formation of sulfur containing anions and preventing a reduction in the Eh of the oral cavity. A method of reducing oral malodor and gingivitis and periodontitis is also provided by this invention.Type: GrantFiled: February 17, 2000Date of Patent: July 23, 2002Assignee: The Research Foundation of State University of New YorkInventors: Israel Kleinberg, Milroy Codipilly
-
Patent number: 6395697Abstract: Aqueous concentrated liquid disinfectant compositions which include: an antiseptic compound other than a quaternary ammonium compound having germicidal properties; organic solvent constituent; binary co-solvent system comprising alkyl biphenyl solvent and a co-solvent; optionally but desirably at least one optional constituents. The concentrate compositions feature excellent blooming characteristics.Type: GrantFiled: March 3, 1999Date of Patent: May 28, 2002Assignee: Reckitt Benckiser Inc.Inventors: Tak Wai Cheung, Dennis Thomas Smialowicz
-
Patent number: 6340455Abstract: Skin prick test for the determination of the predisposition of an individual to develop marginal periodontitis, said kit comprising: (a) a first reagent containing a known quantity of a surface structure common to anaerobic Gram negative pathogens which is capable of triggering the inflammatory response associated with periodontitis and gingivitis; (b) second reagent containing an agonist to said individual; (c) a negative control; and (d) instructions for the use of said kit; and a method for such determination of predisposition.Type: GrantFiled: June 23, 1999Date of Patent: January 22, 2002Assignee: Peridoc ABInventors: Leif Blomlöf, Sven Lindskog, Olle Zetterström
-
Patent number: 6325997Abstract: A method of reducing oral malodor includes providing a solution of sodium chlorite and a metal ion capable of complexing with sulfur and applying the solution as mouth rinse.Type: GrantFiled: December 21, 1999Date of Patent: December 4, 2001Assignee: Oxyfresh Worldwide, Inc.Inventor: William C. Christopfel
-
Patent number: 6280775Abstract: This invention provides a liquid antimicrobial composition that is particularly useful as a mouthwash for treating or reducing the risk of dental disease. The composition is prepared by mixing a first solution comprising a water soluble metal chlorite compound with a second solution comprising sodium persulfate and hydrogen peroxide. The resulting composition, containing chlorine dioxide, is preferably used at the time of preparation by applying the composition to the locus where treatment is desired.Type: GrantFiled: May 19, 2000Date of Patent: August 28, 2001Inventors: Joseph Alan Sasson, Riccardo Panicucci
-
Patent number: 6200551Abstract: A treatment for xerostomia, employing a composition having the active ingredient of carbamide peroxide. The carbamide peroxide compound contains urea and hydrogen peroxide. The hydrogen peroxide remains stable until the carbamide peroxide is applied to the mouth and contacts the water inherent therein. On contact, the hydrogen peroxide is freed from the urea, allowing the hydrogen peroxide to react within the mouth. The resulting chemical and mechanical reaction stimulates saliva within the mouth and thereby relieves the symptoms of xerostomia.Type: GrantFiled: January 27, 2000Date of Patent: March 13, 2001Inventor: Susan Ann Morgan
-
Patent number: 6172032Abstract: A composition comprising: an organic chemical having a chemical group having a dipole moment of at least about 1.5 Debyes and a chemical linker selected from the group consisting of carboxylic acids having 4 to 6 carbon atoms, an ethoxylated polyhydric alcohol, a polyvinyl pyrrolidone and a polyethylene glycol having a molecular weight of about 600 to about 10,000, wherein the molar ratio of organic chemical to chemical linker is about 4:1 to 1:4.Type: GrantFiled: November 17, 1999Date of Patent: January 9, 2001Assignee: Colgate-Palmolive CoInventors: Michele Davister, Guy Broze, Patrick Durbut, Hoai-Chau Cao, Anne-Marie Misselyn, Thomas Connors, John Labows
-
Patent number: 6121315Abstract: Oral compositions including zinc and a coolant provide extended breath freshening without the poor taste and astringency associated with zinc containing compositions.Type: GrantFiled: March 19, 1999Date of Patent: September 19, 2000Assignee: Warner-Lambert CompanyInventors: Mona Nair, Pauline Pan, Lori Kumar
-
Patent number: 6096293Abstract: An oral antiplaque composition for treatment of teeth wherein the essential antiplaque agent is a substantially water insoluble noncationic antibacterial phenol containing, relative to the hydroxyl group, an alkyl or cycloalkyl group, preferably tert.-butyl (t-butyl), in the 2-position, and substituents in one or both of the 4- and 5-positions, one or both of which may be alkyl or cycloalkyl, one being preferably t-butyl.Type: GrantFiled: February 18, 1999Date of Patent: August 1, 2000Assignee: Colgate-Palmolive CompanyInventors: Orum David Stringer, John Brahms, Ernest Kelly, Malathy Subramanian, Stuart Shapiro
-
Patent number: 5994383Abstract: Antimicrobial compositions and methods for preparing and using same are provided. The antimicrobial compositions are surfactant-based and contain certain benzalkonium chloride homologs. The compositions are useful in treating infections in animals and humans, and can be applied to areas including the skin, nails, and mouth.Type: GrantFiled: November 18, 1997Date of Patent: November 30, 1999Assignee: Woodward Laboratories, Inc.Inventors: David L. Dyer, Kenneth B. Gerenraich
-
Patent number: 5989522Abstract: The invention relates to an oral composition for prevention of mycotic infections of the oral cavity comprising an antifungal compound embedded in a sustained release carrier such as a cellulosic polymer, and a method for the use of said composition in preventing microfungal infections in the oral cavity. The invention also provides for the supplementation of said oral composition with an adhesive and a plasticizer to increase antifungal effectiveness.Type: GrantFiled: April 6, 1995Date of Patent: November 23, 1999Assignee: Yissum Research & Development Company of the Hebrew University of JerusalemInventor: Michael Friedman
-
Patent number: 5977166Abstract: A method is disclosed for enhancing flavors in low moisture consumable items, including chewing gum, using menthone ketals. Chewing gum, oral compositions, pharmaceuticals, and low moisture foods containing menthone ketals are provided.Type: GrantFiled: March 24, 1993Date of Patent: November 2, 1999Assignee: WM. Wrigley Jr. CompanyInventor: Michael J. Greenberg