Abstract: High affinity antibodies for binding epitopes of BoNT/A and hybridomas that produce such antibodies are described. The antibodies may be used in a kit for detecting BoNT/A in a sample.

Abstract: The present invention relates to compositions and methods for treating Staphylococcus aureus (S. aureus) infections. In particular, the present invention provides vaccines comprising a Panton-Valentine Leukocidin (u) antigen, antibodies which bind a PVL antigen and compositions containing the same, methods of making such compositions and methods for treating S. aureus infections, including those that are community acquired methicillin-resistant infections. The present invention also provides PVL antibodies, including PVL antibodies specific for a single PVL subunit, and PVL antigens, including conjugated and mutated PVL antigens.

Abstract: Novel bactericidal antibodies against Neisseria meningitidis serogroup B (“MenB”) are disclosed. The antibodies either do not cross-react or minimally cross-react with host tissue polysialic acid and hence pose minimal risk of autoimmune activity. The antibodies are used to identify molecular mimetics of unique epitopes found on MenB or E. coli K1. Examples of such peptide mimetics are described that elicit serum antibody capable of activating complement-mediated bacteriolysis of MenB. Vaccine compositions containing such mimetics can be used to prevent MenB or E. coli K1 disease without the risk of evoking autoantibody.

Abstract: Disclosed are Bacillus thuringiensis strains comprising novel crystal proteins which exhibit insecticidal activity against coleopteran insects including red flour beetle larvae (Tribolium castaneum) and Japanese beetle larvae (Popillia japonica). Also disclosed are novel B. thuringiensis crystal toxin genes, designated cryET33 and cryET34, which encode the colepteran-toxic crystal proteins, CryET33 (29-kDa) crystal protein, and the cryET34 gene encodes the 14-kDa CryET34 crystal protein. The CryET33 and CryET34 crystal proteins are toxic to red flour beetle larvae and Japanese beetle larvae. Also disclosed are methods of making and using transgenic cells comprising the novel nucleic acid sequences of the invention.

Abstract: The present invention is drawn to a penicillin-binding protein expressed by Neisseria meningitidis, or a fragment, or a variant, or a variant fragment thereof, or nucleic acids encoding them, or antibodies or antibody fragments directed against them, as medicaments or in pharmaceutical compositions. The invention is also directed to the use of penicillin-binding proteins expressed by Neisseria meningitidis, or nucleic acids encoding them, or antibodies directed against them for the prophylactic and/or therapeutic immunotherapy of mammals, preferably human beings, against infection by Neisseria meningitidis and/or by a bacterial strain expressing a variant of a Neisseria meningitidis penicillin-binding protein.

Abstract: Monoclonal antibodies, and antigen binding fragments thereof, which bind to Protein A of Staphylococcus aureus are provided.

Abstract: The present invention relates to isolation and identification of novel M. tuberculosis excretory secretory antigen proteins released in vitro/in vivo, raising the specific immunoglobulins and their use as diagnostic reagents for tuberculosis. The invention further relates to a combination of antigens and immunoglobulins for effective detection and immunomonitoring of pulmonary or extrapulmonary Mycobacterium tuberculosis in children and adults by different immunological methods. The invention also relates to detection of tuberculosis with HIV coinfection. Further the invention also shows potential of mycobacterial metallo serine protease (SEVA TB ES-31 antigen) as drug target for screening potential antitubercular drugs.

Abstract: The present invention provides compositions and methods useful for detecting Moraxella catarrhalis. The compositions are antibodies, proteins or nucleic acid sequences specific to Moraxella catarrhalis (M. catarrhalis). The method comprises the steps of obtaining a biological sample from an individual and detecting within the biological sample the presence of proteins, nucleic acid sequences and lipooligosaccharides (LOS) specific to Moraxella catarrhalis. Further, compositions and methods useful for distinguishing between M. catarrhalis serotypes are provided.

Abstract: The present invention pertains to the discovery that B. anthracis possesses a luxS gene that encodes a functional LuxS polypeptide, and that B. anthracis synthesizes a functional AI-2 quorum-sensing molecule. The invention provides mutant B. anthracis bacteria lacking the function of the luxS gene, which do not produce a functional AI-2 molecule and have growth defects compared to wild-type B. anthracis. The invention also concerns methods for inhibiting the growth of B. anthracis, or for preventing or treating B. anthracis infection, by inhibiting the activity of the B. anthracis LuxS polypeptide, or by exposure of the B. anthracis to furanone. In particular, the invention concerns the use of furanone, a compound that inhibits AI-2-mediated quorum-sensing, to inhibit the growth of B. anthracis, to inhibit B. anthracis toxin production, particularly that of protective antigen, and to prevent or treat B. anthracis infection. The invention also provides methods to prevent B.

Abstract: Isolated human monoclonal antibodies which bind to Anthrax protective antigen are disclosed. The human antibodies can be produced in a non-human transgenic animal, e.g., a transgenic mouse, capable of producing multiple isotypes of human monoclonal antibodies by undergoing V-D-J recombination and isotype switching. Also disclosed are derivatives of the human antibodies (e.g., bispecific antibodies and immunoconjugates), pharmaceutical compositions comprising the human antibodies, non-human transgenic animals and hybridomas which produce the human antibodies, and therapeutic and diagnostic methods for using the human antibodies.

Abstract: A composition and method for treating a host having or at risk of infection by Bacillus anthracis using an affinity matured antibody or portion thereof derived from a monoclonal antibody.

Abstract: The present invention relates to antibodies immunologically specific for an attaching and effacing Escherichia coli (AEEC) virulence-associated protein, products, compositions and methods and to their use thereof in the prevention of an AEEC infection in a mammal. The antibody of the invention is immunologically specific for an AEEC virulence-associated protein and is capable of preventing an in vivo AEEC intestinal infection when administered to a mammal. The antibody of the invention is preferably useful for preventing the development of A/E intestinal lesions associated with the AEEC. This is achieved by preferably using IgY antibodies immunologically specific for one or more AEEC virulence-associated proteins, such as Eae, Tir, EspA and Paa.

Abstract: A highly efficient method for generating human antibodies using recall technology is provided. In one aspect, human antibodies which are specific to the anthrax toxin are provided. In one aspect, human peripheral blood cells that have been pre-exposed to anthrax toxin are used in the SCID mouse model. This method results in high human antibody titers which are primarily of the IgG isotype and which contain antibodies of high specificity and affinity to desired antigens. The antibodies generated by this method can be used therapeutically and prophylactically for preventing or treating mammals exposed to anthrax. Thus, in one embodiment, a prophylactic or therapeutic agent used to counter the effects of anthrax toxin, released as a mechanism of bioterrorism, is provided. In one embodiment, a formulation and method for preventing and/or treating anthrax infection comprising a binding agent that prevents the assembly of the PA63 heptamer is also provided.

Abstract: A composition and method for treating a host having or at risk of infection by Bacillus anthracis using an affinity matured antibody or portion thereof derived from a monoclonal antibody.

Abstract: Disclosed are EspFU (EspF-like polypeptide encoded by a gene of the cryptic prophage CP-933U of enterohemorrhagic E. coli) polypeptides, fragments thereof, nucleic acids that encode EspFU polypeptides, or fragments thereof, and cells including the polypeptides, fragments, and/or nucleic acids. Also disclosed are model systems, kits, and methods for screening that use, for example, EspFU polypeptides and nucleic acids. Also included are pharmaceutical and diagnostic compositions and methods of diagnosis and treatment of EHEC infections.

Abstract: A new cytosine deaminase gene and protein from Candida kefyr are provided. This protein has increased ability to convert the 5-fluorocytosine prodrug to its toxic form when compared against the E. coli enzyme.

Abstract: The present invention relates to a monoclonal antibody binding specifically to the p60 protein of Listeria monocytogenes, a hybridoma cell producing the monoclonal antibody, a test kit comprising the monoclonal antibody, and a method for detecting Listeria monocytogenes using the monoclonal antibody. The inventive monoclonal selectively recognizes only Listeria monocytogenes, so that the use of such an antibody allows for rapid determination of the food contamination with these bacteria pathogenic to humans.

Abstract: Monoclonal antibodies which can bind to the ClfA protein and which are generated from binding subdomains or active fragments of the ClfA protein from Staphylococcus aureus, including the active fragments proteins from its fibrinogen binding domain such as Clf40 protein, the Clf33 protein, or ClfA N3, are provided which can be useful in the treatment and protection against infection from staphylococcal bacteria such as Staphylococcus aureus. In addition, medical instruments can be treated using the monoclonal antibodies of the invention in order to reduce or eliminate the possibility of their becoming infected or further spreading the infection. In particular, the antibodies of the present invention are advantageous because they can prevent adherence of the bacteria to host cells by impairing or inhibiting the ability of S. aureus ClfA to bind to fibrinogen or fibrin, and thus can be utilized in methods or treating or preventing staphylococcal inventions.

Abstract: The present invention provides isolated monoclonal antibodies, particularly human antibodies, that bind to CD64 with high affinity. Nucleic acid molecules encoding the antibodies of the invention, expression vectors, host cells and methods for expressing the antibodies of the invention are also provided. Immunoconjugates, bispecific molecules and pharmaceutical compositions comprising the antibodies of the invention are also provided. The invention also provides methods for treating autoimmune disorders, transplant rejection, Graft Versus Host Disease, or cancer and for enhanced presentation of antigen using conjugates of an antigen and an anti-CD64 antibody.

Abstract: Nucleic acid encoding four novel immunodeterminant protein antigens of M. bovis BCG, which is a vaccine strain for tuberculosis, have been isolated. These genes were isolated as immunoreactive recombinant clones from a genomic library of M. bovis BCG DNA and screened with sera collected from tuberculosis patients. The BCG DNA expressed an antigen of Mr 90 kD, and an ORF encoding 761 amino acids encoding a protein of deduced molecular weight 79 kD, was indentified to encode a membrane bound, ion-motive ATPase of M. bovis BCG. The approach described here can be used to identify immunogens of mycobacteria. The well-characterized M. bovis BCG antigens can be used in the prevention, diagnosis and treatment of tuberculosis. The 79 kD antigen is also useful in the design of recombinant vaccines against different pathogens. The sequence of the 79 kD membrane-associated polypeptides also are useful for the development of specific PCR amplification based diagnostic procedures for the detection of mycobacteria.

Abstract: A highly efficient method for generating human antibodies using recall technology is provided. In one aspect, human antibodies which are specific to the anthrax toxin are provided. In one aspect, human peripheral blood cells that have been pre-exposed to anthrax toxin are used in the SCID mouse model. This method results in high human antibody titers which are primarily of the IgG isotype and which contain antibodies of high specificity and affinity to desired antigens. The antibodies generated by this method can be used therapeutically and prophylactically for preventing or treating mammals exposed to anthrax. Thus, in one embodiment, a prophylactic or therapeutic agent used to counter the effects of anthrax toxin, released as a mechanism of bioterrorism, is provided. In one embodiment, a formulation and method for preventing and/or treating anthrax infection comprising a binding agent that prevents the assembly of the PA63 heptamer is also provided.

Abstract: A highly efficient method for generating human antibodies using recall technology is provided. In one aspect, human antibodies which are specific to the anthrax toxin are provided. In one aspect, human peripheral blood cells that have been pre-exposed to anthrax toxin are used in the SCID mouse model. This method results in high human antibody titers which are primarily of the IgG isotype and which contain antibodies of high specificity and affinity to desired antigens. The antibodies generated by this method can be used therapeutically and prophylactically for preventing or treating mammals exposed to anthrax. Thus, in one embodiment, a prophylactic or therapeutic agent used to counter the effects of anthrax toxin, released as a mechanism of bioterrorism, is provided. In one embodiment, a formulation and method for preventing and/or treating anthrax infection comprising a binding agent that prevents the assembly of the PA63 heptamer is also provided.

Abstract: The present invention relates to the field of animal health and in particular to Lawsonia intracellularis. In particular, the invention relates to a method of diagnosing Lawsonia intracellularis infection and a diagnostic test kit using Lawsonia intracellularis-specific antibodies. The invention also relates to the use of the method or test kit for diagnosing Lawsonia intracellularis infections.

Abstract: Novel proteins and their corresponding nucleotide sequences in enteroaggregative Escherichia coli (EAEC) are provided. In particular, Aap and the five gene cluster (aat) of the AA probe region of the pAA plasmid of EAEC 042 have been identified, sequenced, and further characterized. The use of these novel proteins and their corresponding nucleotide sequences for diagnosis, therapy, and prevention of EAEC infections is also provided.

Abstract: Novel proteins and their corresponding nucleotide sequences in enteroaggregative Escherichia coli (EAEC) are provided. In particular, Aap and the five gene cluster (aat) of the AA probe region of the pAA plasmid of EAEC 042 have been identified, sequenced, and further characterized. The use of these novel proteins and their corresponding nucleotide sequences for diagnosis, therapy, and prevention of EAEC infections is also provided.

Abstract: A novel Helicobacter pylori blood group antigen binding (BAB) adhesin protein was isolated and purified, whereby said protein or fractions thereof bind specifically to fucosylated blood group antigens. The protein sequence of said adhesin is disclosed in this application. Simultaneously the DNA sequences for two genes, babA and babB, producing highly similar proteins, are disclosed. Said adhesin and/or DNA is useful for diagnose and therapy and/or prophylaxis directed against H. pylori induced infections, e.g. gastritis and acid peptic disease, i.e. active vaccination. A new immunoglobulin composition, which exhibits specific activity to a Lewisb antigen binding Helicobacter pylori adhesin, or preferably, monoclonal and/or polyclonal antibodies to said adhesin offer a new and more efficient method of treatment and/or prevention of gastrointestinal diseases, caused by Helicobacter pylori or other Helicobacter species, i.e. passive vaccination.

Abstract: The present invention encompasses monoclonal antibodies that bind to lipoteichoic acid (LTA) of Gram positive bacteria. The antibodies also bind to whole bacteria and enhance phagocytosis and killing of the bacteria in vitro. The invention also provides antibodies having human sequences (chimeric, humanized and human antibodies). The invention also sets forth the variable regions of three antibodies within the invention and presents the striking homology between them.

Abstract: Antibodies to the CNA protein and to other regions from the collagen binding domain, including domain CNA19, are provided, and antibodies produced in this manner have been shown to be cross reactive to both Staphylococcus aureus and Staphylococcus epidermidis bacteria and which can thus be used in the prevention and treatment of infections caused by both of these types of bacteria. In addition, medical instruments can be treated using the antibodies of the invention in order to reduce or eliminate the possibility of their becoming infected or further spreading the infection. In particular, the proteins are advantageous because they are cross-reactive and may thus be administered to patients so as to reduce or prevent severe infection by staphylococcal bacteria of more than one species.

Abstract: The present invention relates to peptides, particularly human monoclonal antibodies, that bind specifically to P. aeruginosa mucoid exopolysaccharide. The invention further provides methods for using these peptides in the diagnosis, prophylaxis and therapy of P. aeruginosa infection and related disorders (e.g., cystic fibrosis). Some antibodies of the invention enhance opsonophagocytic killing of multiple mucoid strains of P. aeruginosa. Compositions of these peptides, including pharmaceutical compositions, are also provided, as are functionally equivalent variants of such peptides.

Abstract: A specific region of chromosome 10 (10q23.3) has been implicated by series of studies to contain a tumor suppressor gene involved in gliomas, as well as a number of other human cancers. One gene within this region was identified, and the corresponding coding region of the gene represents a novel 47 kD protein. A domain of this product has an exact match to the conserved catalytic domain of protein tyrosine phosphatases, indicating a possible functional role in phosphorylation events. Sequence analyses demonstrated the a number of exons of the gene were deleted in tumor cell lines used to define the 10q23.3 region, leading to the classification of this gene as a tumor suppressor. Further analyses have demonstrated the presence of a number of mutations in the gene in both glioma and prostate carcinoma cells. Methods for diagnosing and treating cancers related to this tumor suppressor, designated as TS10q23.3, also are disclosed.

Abstract: A new fibrinogen binding protein or polypeptide originating from coagulase negative staphylococci, biotechnological methods for producing the protein or polypeptide having fibrinogen binding activity and a recombinant DNA molecule coding for the protein (or fragments thereof), and micro-organisms (including viruses) containing this recombinant DNA molecule. The present invention further comprises the therapeutic and diagnostic use of the protein and/or DNA, e.g., a diagnostic kit for determining the presence and/or type of coagulase negative staphylococci and a vaccine composition, comprising the protein or DNA.

Abstract: A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO. 2) and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

Abstract: The present invention provides compositions, medicaments, and methods for the treatment or prophylaxis of conditions associated with the binding of Streptococcus mutans to teeth. Specifically, the present invention provides a method for preventing dental caries and infective endocarditis in a subject by treating the subject's oral cavity with a composition or medicament comprising the competence stimulating peptide (CSP) of the causative bacterium, which inhibits the ability of the said bacteria to attach to the surface of teeth. Novel anti-caries compositions using the CSP are also disclosed.

Abstract: The invention described herein provides human antibodies produced in non-human animals that specifically bind to Streptococcus pneumoniae capsular polysaccharide (PPS-3). The invention further provides methods for making the antibodies in a non-human animal and for expressing the antibodies in cells including hybridomas and recombinant host cell systems. Kits and pharmaceutical compositions comprising the antibodies are also provided in addition to methods of treating, inhibitng or preventing S. pneumoniae infection or conditions or disorders caused by such infection by administering to a patient the pharmaceutical compositions described herein.

Abstract: Polyspecific immunoconjugates and antibody composites that bind a multidrug transporter protein and an antigen associated with a tumor or infectious agent are used to overcome the multidrug resistant phenotype. These immunoconjugates and composites also can be used diagnostically to determine whether the failure of traditional chemotherapy is due to the presence of multidrug resistant tumor cells, multidrug resistant HIV-infected cells or multidrug resistant infectious agents.

Abstract: The present invention provides a novel method for the identification and clonal isolation of antibodies that bind to unique epitopes. The method is based on the use of antibodies as solid phase capture reagents to bind a known capture antibody epitope, thereby precluding the capture antibody epitope from being presented to a population of antibodies to be screened. The method is particularly suited for screening libraries of cloned antibodies, such as phage display combinatorial antibodies. An antibody specific for herpes simplex virus (HSV), was employed as a model for the assay.

Abstract: Antibodies for binding epitopes of BoNT/A and hybridomas which produce such antibodies are described. The antibodies of the present invention can be used in a method for detecting BoNT/A in a sample and/or in a method for purifying BoNT/A from an impure solution. In addition, the antibodies can be used for passive immunization against BoNT/A intoxication or as intoxication therapy. Another aspect of the invention is a kit for detecting BoNT/A in a sample.

Abstract: The present invention provides polypeptides comprising an immunogenic epitope of a M. vaccae protein, polynucleotides encoding such polypeptides, and fusion proteins comprising at least one such polypeptide, together with genetic constructs comprising at least one inventive polynucleotide. Compositions comprising such polypeptides, polynucleotides, fusion proteins and/or genetic constructs may be employed in the treatment of infectious diseases and immune disorders.

Abstract: Compositions that inhibit the binding of Plasmodium falciparum to erythrocytes are provided. More particularly, antibodies specific for Plasmodium falciparum binding proteins and blocking peptides that prevent the binding of Plasmodium falciparum are included in the present invention. The methods provided utilize the antibody and peptide compositions provided herein and include methods for the diagnosis, prevention, and treatment of Plasmodium falciparum diseases such as malaria as well as methods for the detection of Plasmodium falciparum in biological samples and culture media.

Abstract: It is possible to inactivate the early stage of lipid A synthesis of mucosal gram negative bacteria without compromising cell viability. In particular the lpxA gene in N. meningitidis was mutated and resulting lpxA knockout mutants were found to be completely lipopolysaccharide (LPS)-deficient. The major outer membrane proteins (OMPs) were detected in normal amounts. The finding provides important implications for understanding of structure and biogenesis of the outer membrane. On a practical level, the availability of LPS-deficient mutants of pathogenic mucosal bacteria such as N. meningitidis opens up new avenues to vaccine development. It enables easy isolation of endotoxin-free purified proteins, outer membranes or even whole-cell preparations for use in immunisation.

Abstract: The subject of the invention is amino acid sequences of the AC-Hly from B. pertussis, B. parapertussis and/or B. bronchiseptica, carrying epitopes capable of inducing a protective immune response against infection by Bordetella. The subject of the invention is antibodies, especially monoclonal antibodies, directed against these epitopes.

Abstract: Monoclonal antibodies which can bind to the ClfA protein and which are generated from binding subdomains or active fragments of the ClfA protein from Staphylococcus aureus, including the active fragments proteins from its fibrinogen binding domain such as Clf40 protein, the Clf33 protein, or ClfA N3, are provided which can be useful in the treatment and protection against infection from staphylococcal bacteria such as Staphylococcus aureus. In addition, medical instruments can be treated using the monoclonal antibodies of the invention in order to reduce or eliminate the possibility of their becoming infected or further spreading the infection. In particular, the antibodies of the present invention are advantageous because they can prevent adherence of the bacteria to host cells by impairing or inhibiting the ability of S. aureus ClfA to bind to fibrinogen or fibrin, and thus can be utilized in methods or treating or preventing staphylococcal inventions.

Abstract: The present invention relates to a protienaceous compound or functionally active derivative or part thereof having a binding site for a group represented by formula (I) which is part of a group of toxins derived from various cyanobacteria, to a method for its production, to diagnostic kits and to an affinty matrix (e.g. for use in immunoaffinity columns, online detection and purifications devices) containing the proteinaceous compound as well as to methods for substantially decreasing the amount of a compound containing the group represented by formula (I) in fluids or for concentrating compounds, e.g. toxins, containing the group represented by formula (I) from fluids such as crude water samples, extracts of algae or other tissue samples, e.g. to determine toxin concentrations.

Abstract: The invention relates to agents and processes for detecting bacteria of the genus Listeria, in particular L. monocytogenes. The agents according to the invention include primers whose sequence is selected from the iap gene of L. monocytogenes. In addition, the agents according to the invention include peptides whose sequence is selected from the p60 protein and which are suitable for producing specific antibodies for the immunological detection of L. monocytogenes.

Abstract: The present invention describes the isolation and purification of histidine-tagged functional portions of intimin (his-tagged intimin or his-intimin), a protein associated with the ability of certain strains of pathogenic bacteria to adhere to epithelial cells. The invention further describes the use of intimin as an antigen to promote a protective immune response. In addition, the invention describes the combination of intimin with one or more other antigens and administration of the combination to promote a protective immune response against intimin and the one or more antigens. One aspect of the invention is the administration of intimin to target specific epithelial cells to promote a protective immune response to intimin proteins. Additional aspects of the invention include the use of intimin or intimin combined with one or more antigens and administration of the combination to target gastrointestinal mucosa and stimulate an immune response.

Abstract: The present invention encompasses monoclonal and chimeric antibodies that bind to lipoteichoic acid of Gram positive bacteria. The antibodies also bind to whole bacteria and enhance phagocytosis and killing of the bacteria in vitro and enhance protection from lethal infection in vivo. The mouse monoclonal antibody has been humanized and the resulting chimeric antibody provides a previously unknown means to diagnose, prevent and/or treat infections caused by gram positive bacteria bearing lipoteichoic acid. This invention also encompasses a peptide mimic of the lipoteichoic acid epitope binding site defined by the monoclonal antibody. This epitope or epitope peptide mimic identifies other antibodies that may bind to the lipoteichoic acid epitope. Moreover, the epitope or epitope peptide mimic provides a valuable substrate for the generation of vaccines or other therapeutics.

Abstract: The CAMP factor gene of Streptococcus uberis (S. uberis) is described, as well as the recombinant production of CAMP factor therefrom. Also disclosed are chimeric CAMP factor constructs, including CAMP factor epitopes from more than one bacterial species. The CAMP factors and chimeras including the same can be used in immunogenic compositions for the prevention and treatment of bacterial infections.

Abstract: The present invention related to biotechnology and genetic engineering, particularly the expression of proteins of viral origin in microorganisms through their fusion by applying recombinant DNA technology to bacterial peptides. The present invention provides an effcient process for the expression in Escherichia coli of heterlogous proteins as fusion peptides with a view to obtaining them with a high degree of purity, in commercially useful amounts, and in an appropriate form for their inclusion in vaccine preparations. What is essentially used is a stabilizing sequence derived from the first 47 amino acids of the antigen P64k of Neisseria meningitides B:4:P1.15. In particular, use is made of a recombinant plasmid containing said sequence, under the control of the tryptophane promoter of E. coli and of the terminator of the transcription of the phage T4, including restrictions sites which provide for the cloning in phase of DNA fragments coding for polypeptides of interest.

Abstract: The present invention provides monoclonal antibodies which are highly specific for Bacillus spores. Also provided are peptides derived from those monoclonal antibodies. Both the antibodies and peptides are highly specific and can discriminate between spores of potentially lethal organisms such as Bacillus anthracis and other harmless but closely related bacilli and provide a very powerful tool in the construction of detection instruments as counter measures.

Abstract: The CAMP factor gene of Streptococcus uberis (S. uberis) is described, as well as the recombinant production of CAMP factor therefrom. CAMP factors can be used in vaccine compositions for the prevention and treatment of bacterial infections.