Abstract: The present invention is primarily directed to a method for preventing infection of a mammalian subject with S. pneumoniae, wherein said method comprises administering to said subject an effective amount of one or more S. pneumoniae cell wall and/or cell membrane proteins and/or immunogenically-active fragments, derivatives or modifications thereof, wherein said proteins are selected from a defined group of immunogenic proteins. The present invention further provides vaccine compositions containing said cell wall and/or cell membrane proteins.

Abstract: The invention provides a nucleic acid encoding the 37-kDa pneumococcal surface adhesion A protein (PsaA) from Streptococcus pneumoniae. Also provided are isolated nucleic acids comprising a unique fragment of at least 10 nucleotides of the 37-kDa protein. The invention also provides purified polypeptides encoded by the nucleic acid encoding the 37-kDa protein from and the nucleic acids comprising unique fragment of at least 10 nucleotides of the 37-kDa protein. The invention further provides monoclonal antibodies which selectively bind PsaA. In addition, peptides are provided that immunospecifically bind to the monoclonal antibodies of the invention, and that are immunogenic against Streptococcus pneumoniae infection. Additionally, multiple antigenic peptides that provide protection against S. pneumoniae challenge are provided. These multiple antigen peptides comprise the peptides that immunospecifically bind to the monoclonal antibodies.

Abstract: Methods for treating cardiac muscle disorders, such as cardiac arrhythmias, by administration of a neurotoxin to cardiac muscle are disclosed. Bradycardia can be alleviated for several months by a single intrapericardial or intracardiac injection or infusion of a botulinum toxin. Tachycardia can be alleviated by preganglionic sympathetic nervous system administration of a botulinum toxin.

Abstract: A cytotoxin can be rendered non-toxic by charge neutralizing the amino acids salient to pore assembly and/or sterically inhibiting formation of the peptide's active conformation. In the presence of specific proteases, the inactive peptide or procytotoxin can be activated to assemble into its lytic conformation and selectively destroy a target cell.

Abstract: Compounds of general formula (I) wherein R1, R2, R3 are as defined and R4 groups are each independently selected from NR2, O and S; are of use in treatment of cancers.

Abstract: A class of procytotoxic agents is characterized by a capability to kill with target cell-specificity. Such an aspect can be a pore-forming protein which has at least one lysine residue, modified by a peptide linkage to an amino acid residue, via the epsilon amino group. These agents are useful in treating cancer, especially prostate cancer.

Abstract: A mutant hydrolase optionally fused to a protein of interest is provided. The mutant hydrolase is capable of forming a bond with a substrate for the corresponding nonmutant (wild-type) hydrolase which is more stable than the bond formed between the wild-type hydrolase and the substrate and has at least two amino acid substitutions relative to the wild-type hydrolase. Substrates for hydrolases comprising one or more functional groups are also provided, as well as methods of using the mutant hydrolase and the substrates of the invention. Also provided is a fusion protein capable of forming a stable bond with a substrate and cells which express the fusion protein.

Abstract: This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID. NO: 1) Eight mer peptides from within the consensus peptide were tested against an antibody raised to the consensus peptide. Studies relating to antibody raised to denatured proteins from the natural organisms producing the family of proteins were also useful and showed particular value of some sequences. A sequence of the formula ASVDPTIDLLQA (SEQ ID NO: 2) was identified thereby. An enlarge sequence of the formula TVTASVDPTIDLLQAD (SEQ ID NO: 3) is also especially interesting as are intermediate sequences such as sequences VTASVDPTIDLLQAD (SEQ ID NO: 4), TASVDPTIDLLQAD (SEQ ID NO: 5), and TASVDPTIDLLQA (SEQ ID NO: 6) as being binding sites for antibodies raised to the denatured proteins.

Abstract: The present invention provides methods for eliciting an immune response against Group A streptococci, comprising use of recombinant fusion polypeptides, and compositions thereof, that include a multivalent immunogenic portion of at least two immunogenic polypeptides from Group A streptococci M proteins (which are capable of stimulating a protective immune response against Group A streptococci), and a reiterated polypeptide from the immunogenic portion carboxy-terminal to the immunogenic portion, wherein the carboxy-terminal polypeptide is not required to stimulate an immune response against Group A streptococci.

Abstract: A composition is prepared from a mixture of different vesicles, such as outer membrane vesicles (OMVs) and vaccines are based thereon. Another composition comprises in a single vesicle a combination of antigens and/or other vesicle components deriving from separate vesicles; again vaccines are prepared therefrom.

Abstract: The inventive subject matter relates to a recombinant 110 kDa protein from O. tsutsugamuchi, Karp, Kato and Gilliam strains and for a DNA expression system containing DNA encoding the 110 kDa protein of O. tsutsugamuchi. The invention also relates to the use of these recombinant contructs in a formulation for the induction of a protective immune response against O. tsutsugamuchi invection using. The inventive subject matter also relates to a recombinant 110 kDa O. tsutsugamuchi protein or 110 kDa fragments for the production of antigen for use in immunodiagnosistic asssays for scrub typhus.

Abstract: The invention provides a method of inhibiting prophylactically or therapeutically an influenza viral infection in a host. The method comprises instilling into or onto a host a cell producing an antiviral protein, antiviral peptide, or antiviral conjugate comprising at least nine contiguous amino acids of SEQ ID NO: 2, wherein the at least nine contiguous amino acids are nonglycosylated and have antiviral activity, whereupon the influenza viral infection is inhibited.

Abstract: A scrub typhus vaccine comprising truncated r47 protein and truncated r56 protein is disclosed. Vaccines composed of r56 protein variants are also disclosed. Methods of reducing HIV viral loads using r47 and r56 proteins and antibodies raised against r47 and r56 are also disclosed.

Abstract: The subject invention relates to novel Xenorhabdus toxin complex (TC) proteins encoded by genes from Xenorhabdus bovienii strain ILM 104, and methods of controlling an insect with the toxin proteins.

Abstract: Mucosal DTPa vaccines, especially intranasal vaccines, comprising (a) a diphtheria antigen, a tetanus antigen and an acellular pertussis antigen, and (b) a detoxified mutant of cholera toxin (CT) or E. coli heat labile toxin (LT). Component (b) acts as a mucosal adjuvant. The acellular pertussis antigen preferably comprises pertussis holotoxin (PT) and filamentous haemagglutinin (FHA) and, optionally, pertactin. The mucosally-delivered combined DTPa formulation is capable of generating a level of protection against B. pertussis infection equivalent to that observed by alum-adjuvanted parenteral administration.

Abstract: Compositions and methods for making and using therapeutic formulations of multivalent hybrid polypeptides comprising immunogenic peptides of M proteins from various different serotypes of group A streptococci and antibodies thereto are provided. Also provided are nucleic acids encoding such hybrid polypeptides. The hybrid polypeptide formulations may be used, for example, in methods for treating or preventing a microbial infection and eliciting a protective immune response having broadly protective opsonic antibodies in the absence of tissue cross-reactive antibodies.

Abstract: In this application is described a composition, Invaplex, derived from a gram negative bacteria for use in generating an immune response in a subject against one or more heterologous species or strains of gram-negative bacteria.

Abstract: Novel vaccines for use against ?-hemolytic Streptococcus colonization or infection are disclosed. The vaccines contain an immunogenic amount of a variant of streptococcal C5a peptidase (SCP). Also disclosed is a method of protecting a susceptible mammal against ?-hemolytic Streptococcus colonization or infection by administering such a vaccine. Enzymatically inactive SCP, and polynucleotides encoding these SCP proteins are further disclosed.

Abstract: The present invention provides methods for eliciting an immune response against Group A streptococci, comprising use of recombinant fusion polypeptides, and compositions thereof, that include a multivalent immunogenic portion of at least two immunogenic polypeptides from Group A streptococci M proteins (which are capable of stimulating a protective immune response against Group A streptococci), and a reiterated polypeptide from the immunogenic portion carboxy-terminal to the immunogenic portion, wherein the carboxy-terminal polypeptide is not required to stimulate an immune response against Group A streptococci.

Abstract: The present invention features peptides of a PorB polypeptide, which PorB peptides are useful in production of antibodies that bind the full-length PorB polypeptide and as a therapeutic agent. In specific embodiments the invention features a composition comprising one or more PorB peptides (other than a full-length PorB polypeptide), which peptides contain at least one epitope that can elicit Chlamydia-neutralizing antibodies. The invention also features methods for induction of a protective immune response against infection by Chlamydia and Chlamydiophila.

Abstract: The present invention relates to a method of producing recombinant modified Staphylococcal toxin having improved stability, comprising the steps of preparing a modified toxin in which a specific amino acid sequence is substituted and a vector for expressing the modified toxin, and culturing E. coli transformed with the vector, and a use thereof for the vaccine.

Abstract: Peptides are disclosed that include SEQ ID NO:1, SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, and SEQ ID NO:6, or a conservative variant or mimic thereof, wherein the conservative variant or mimic specifically binds an antibody that specifically binds SEQ ID NO:1, SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID or NO:6. These peptides are of use in generating an immune response against C. pneumoniae, or in preventing infection with against C. pneumoniae.

Abstract: The object of the invention is to provide proteins that have both DNA primase activity and DNA polymerase activity. This subject is solved by a protein (p41) that has an amino acid sequence shown in SEQ ID NO: 1. This is for the first time that proteins that have both DNA primase activity and DNA polymerase activity were found. A protein (p46) that has amino acid sequence shown in SEQ ID NO: 2 forms a complex with p41, and enforces DNA synthesis activity that is independent and/or dependent from primer of p41.

Abstract: A polypeptide, called Tir (for translocated intimin receptor, which is secreted by attaching and effacing pathogens, such as the enteropathogenic (EPEC) and enterohemorrhagic (EHEC) E. coli. These bacterial pathogens inserts their own receptors into mammalian cell surfaces, to which the bacterial pathogen then adheres to trigger additional host signaling events and actin nucleation. Diagnosis of disease caused by pathogenic E. coli can be performed by the use of antibodies which bind to Tir to detect the protein or the use of nucleic acid probes for detection of nucleic acids encoding Tir polypeptide. Isolated nucleic acid sequences encoding Tir polypeptide, Tir peptides, a recombinant method for producing recombinant Tir, antibodies which bind to Tir, and a kit for the detection of Tir-producing E. coli are provided. A method of immunizing a host with Tir to induce a protective immune response to Tir or a second polypeptide of interest is also provided.

Abstract: Sequences encoding two immunoreactive glycoproteins were cloned from Ehrlichia canis (p153 gene) and Ehrlichia chaffeensis (p156 gene). These two glycoproteins are species-specific immunoreactive orthologs that are useful as subunit vaccines and for serologic and molecular diagnostics for E. canis and E. chaffeensis.

Abstract: The present invention relates to soluble P. gingivalis polypeptides derived from PG32 and PG33 and to polynucleotides encoding these polypeptides. The P. gingivalis polypeptides and nucleotides can be used in compositions for use in raising an immune response in a subject against P. gingivalis and treating or preventing or reducing the severity of the condition known as periodontitis or in other conditions related to infection with P. gingivalis.

Abstract: A single polypeptide is provided which comprises first and second domains. The first domain enables the polypeptide to cleave one or more vesicle or plasma-membrane associated proteins essential to exocytosis, and the second domain enables the polypeptide to be translocated into a target cell or increases the solubility of the polypeptide, or both. The polypeptide thus combines useful properties of a clostridial toxin, such as a botulinum or tetanus toxin, without the toxicity associated with the natural molecule. The polypeptide can also contain a third domain that targets it to a specific cell, rendering the polypeptide useful in inhibition of exocytosis in target cells. Fusion proteins comprising the polypeptide, nucleic acids encoding the polypeptide and methods of making the polypeptide are also provided. Controlled activation of the polypeptide is possible and the polypeptide can be incorporated into vaccines and toxin assays.

Abstract: The present invention relates to peptide mimics of a conserved gonococcal epitope of Neisseria gonorrhoeae, which epitope is not found on human blood group antigens. This invention also relates to methods and compositions using such peptide mimics for the prophylaxis of gonorrheal infections.

Abstract: The invention relates to stabilized antigen compositions of Erysipelothrix rhusiopathiae and vaccine formulations containing such antigen compositions. Antigens of the invention are effective in providing long-term protection against erysipelas in animals.

Abstract: The present invention relates to a vaccine for inducing an immune response to an antigen in a vertebrate (e.g., mammal) comprising an antigen and all or a portion of a stress protein or all or a portion of a protein having an amino acid sequence sufficiently homologous to the amino acid sequence of the stress protein to induce the immune response against the antigen. In a particular embodiment, the present invention relates to vaccines and compositions which induce a CTL response in a mammal comprising an antigen and all or a portion of a stress protein. In another embodiment, the invention relates to vaccines and compositions which induce an immune response to an influenza virus in a mammal comprising an antigen of the influenza virus and all or a portion of one or more stress proteins. The invention also relates to vaccines and compositions for inducing a CTL response to a tumor-associated antigen comprising a tumor-associated antigen and all or a portion of the stress protein.

Abstract: Vaccines and methods against M. haemolytica infections in cattle. The vaccine compositions include a recombinant outer membrane protein of M. haemolytica designated PlpE and/or subunits thereof, alone or in combination with other antigenic components, and a carrier or diluent. The methods involve administering an effective immunizing amount of the vaccines to susceptible bovine.

Abstract: This invention provides polypeptides of Helicobacter pylori cytotoxin associated immunodominant (CAI) antigen. The invention also provides prophylactic and therapeutic vaccines comprising polypeptides of Helicobacter pylori CAI antigen, and methods for their preparation. The invention also provides methods of treatment of Helicobactor pylori infection using these vaccines.

Abstract: The present invention relates to novel immunogenic polypeptides, and fragments thereof, and vaccines for the prevention and treatment of pneumococcal infection, especially by Streptococcus pneumoniae. The invention also relates to antibodies against the disclosed polypeptides, as well as vaccines containing said polypeptides and methods of disease prevention.

Abstract: The present invention discloses amino acid sequences and nucleic acid sequences relating to a Streptococcus Pneumoniae surface associated Pneumo Protective Protein (PPP) having a molecular weight of about 20 kilo Daltons (kDa). The PPP exhibits the ability to reduce colonization of pneumococcal bacteria. Thus the present invention also pertains to compositions for the treatment and prophylaxis of infection or inflammation associated with bacterial infection.

Abstract: Outer-membrane vesicles, Class 1 outer membrane proteins of Neisseria meningitidis, fragments or oligopeptides containing epitopes of the Class I OMP can be used to immunize against meningococcal disease.

Abstract: The present invention features peptides of a PorB polypeptide, which PorB peptides are useful in production of antibodies that bind the full-length PorB polypeptide and as a therapeutic agent. In specific embodiments the invention features a composition comprising one or more PorB peptides (other than a full-length PorB polypeptide), which peptides contain at least one epitope that can elicit Chlamydia-neutralizing antibodies. The invention also features methods for induction of a protective immune response against infection by Chlamydia and Chlamydiophila.

Abstract: A class of procytotoxic agents is characterized by a capability to kill with target cell-specificity. Such an aspect can be a pore-forming protein which has at least one lysine residue, modified by a peptide linkage to an amino acid residue, via the epsilon amino group. These agents are useful in treating cancer, especially prostate cancer.

Abstract: A method of inducing either a TH1 polarized immune response, a TH2 polarized immune response or a combined TH1 and TH2 response to an antigen and associated vaccine formulations are disclosed. A method is provided for inducing a polarized TH1 response by parenteral administration of microparticles sized such that at least 50% of the microparticles are less than 5 ?m. The microparticles containing antigen entrapped or encapsulated by a biodegradable polymer. Additionally, a method is provided for inducing a polarized TH2 response by parenteral administration of nanoparticles sized such that at least 50% of the nanoparticles are less than 600 nm, the nanoparticles containing antigen entrapped or encapsulated by a biodegradable polymer. Vaccine formulations containing the B. pertussis antigens PTd, FHA or a combination of PTd and FHA are provided.

Abstract: Various immunologically active proteins from Borrelia burgdorferi have been prepared by genetic manipulation in microorganisms. To do this, the specific DNA sequences were selected from a B. burgdorferi gene bank using suitable screening methods, or were prepared directly by DNA amplification using selected hybridization probes, and were placed under the control of inducible promoters such as, for example, the lac promoter. It has been possible, owing to description of efficient purification methods for the expressed antigens, to provide the proteins in a suitable way. These proteins can be used to produce specific and sensitive diagnostic assay kits. The specific combination of the immunologically active proteins makes precise diagnosis possible. Furthermore, monoclonal antibodies have been generated and are used as reagents for detecting pathogens directly in test samples or after cultivation.

Abstract: Methods and compositions for the treatment of microbial infection, and in particular meningococcal disease, comprise a commensal Neisseria or an extract of a commensal Neisseria. Further methods and compositions comprise conimensal Neisseria which express genes from virulent strains of Neisseria and/or heterologous gene products from non-Neisserial sources. Such compositions are used in vaccine preparations for the treatment of microbial infection.

Abstract: The invention relates to nucleic acid molecules encoding (poly)peptides having chemotaxis inhibiting (poly)peptides CHIPS activity, to recombinant vectors harboring such molecules, and the host cells carrying the vectors. The invention further relates to methods for preparing recombinant (poly)peptides having CHIPS activity and to the use of such recombinant (poly)peptides having CHIPS activity for diagnosis, prophylaxis and treatment, such as the treatment of inflammation reactions and HIV. In addition, the invention provides therapeutic and diagnostic compositions comprising as the active ingredient the (poly)peptide having CHIPS activity.

Abstract: Recombinant hybrid streptococcal M protein antigens are provided which elicit protective antibodies against Group A streptococci and prevent rheumatic fever. Recombinant hybrid genes which encode the antigen are provided. Vaccine compositions and methods of administering the compositions are provided to elicit immunity against Group A streptococci.

Abstract: The present invention provides the discovery of a new Streptococcus protective antigen (herein designated Spa) which has been identified and isolated from Streptococci. Spa is a surface antigen distinct from M protein which evokes opsonic antibodies that are protective against multiple serotypes of streptococci. The invention further provides isolated Spa polypeptides, proteins, peptides, and antibodies against the same, as well as nucleic acids encoding Spa polypeptide and peptide antigens. Also provided are methods for identification and isolation of a Spa polypeptide, therapeutic compositions comprised of Spa antigens or antibodies and methods of their use in protecting an animal against a Streptococcus infection.

Abstract: A novel antigen from P. aeruginosa is provided. The use of the antigen in detecting/diagnosing P. aeruginosa as well as its use in eliciting an immune response are also provided.

Abstract: The present invention relates generally to therapeutic compositions for the treatment and/or prophylaxis of intestinal disease conditions in animals and birds caused or exacerbated by Lawsonia intracellularis or similar or otherwise related microorganism. The present invention also contemplates methods for the treatment and/or prophylaxis of such intestinal disease conditions and to diagnostic agents and procedures for detecting Lawsonia intracellularis or similar or otherwise related microorganism.

Abstract: The present invention generally relates to compositions and methods for preventing and treating human diseases including, but not limited to, pathogens such as bacteria, yeast, parasites, fungus, viruses, and cancer. More specifically, embodiments described herein concern the manufacture and use of ligand/receptor specificity exchangers, which redirect existing antibodies in a subject to receptors present on pathogens.

Abstract: A vaccine, effective in inducing the production of antibodies with which to immunize a second subject passively against infection by Gram-negative bacteria and LPS-mediated pathology, comprises a non-covalent polyvalent complex formed between purified, detoxified LPS derived from E. coli and purified outer membrane protein derived from N. meningitidis. The same vaccine will also actively immunize a host subject against Gram-negative bacterial infections and LPS-mediated pathology. Meningococcal infections are included among those Gram-negative bacterial infections protected against by the vaccine.

Abstract: An isolated, biologically active 33 kDa hemagglutinin purified from the type A Clostridium botulinum neurotoxin complex and its uses are described.

Abstract: This invention comprises a recombinant protein comprising the maltose binding protein (MBP) of Escherichia coli fused to amino acids 5–337 of the FlaA flagellin of Campylobacter coli VC167 which has provided evidence of immunogenicity and protective efficacy against challenge by a heterologous strain of campylobacter, Campylobacter jejuni 81–176 in mammals. The invention further comprises a recombinant DNA construct encoding the immunodominant region (region I through III) of flagellin from Campylobacter spp. for use as a component of a vaccine against Campylobacter diarrhea. The invention therefore represents an effective treatment against Campylobacter but avoids inducing the autoimmune Guillain Barre Syndrome (GBS), a post-infection polyneuropathy caused by Campylobacter molecular mimicry of human gangliosides which has hampered the development of vaccines heretofore.

Abstract: A process for the preparation of biologically active somatotropin from inclusion bodies of a recombinant host cell containing an inactive form of said somatotropin protein comprises the steps of: (a) contacting the inclusion bodies with an aqueous alcohol solution at an alkaline pH to solubilize said protein; and (b) bringing the solubilized protein into contact with a mild oxidizing agent to refold and form intramolecular disulfide bonds between cysteine residues of said protein.