Abstract: A canine respiratory coronavirus (CRCV) that is present in the respiratory tract of dogs with canine infectious respiratory disease and which has a low level of homology to the enteric canine coronavirus, but which has a high level of homology to all bovine coronavirus strains (e.g., Quebec and LY138) and human coronavirus strain OC43.

Abstract: Fusion proteins of recombinant SARS coronavirus structural proteins, their production and uses are provided. An optimized SARS coronavirus S protein gene which can be highly expressed in the mammalian cell strains and SARS coronavirus S protein variants comprising deletion, modification or mutation amino acids 318-510 corresponding to SARS coronavirus S protein are also provided.

Abstract: A new pantropic canine coronavirus (CCoV) strain, having reduced pathogenicity, and capable of eliciting an immune response, is described.

Abstract: A canine respiratory coronavirus (CRCV) that is present in the respiratory tract of dogs with canine infectious respiratory disease and which has a low level of homology to the enteric canine coronavirus, but which has a high level of homology to all bovine coronavirus strains (eg Quebec and LY138) and human coronavirus strain OC43. The CRCV spike, polymerase and hemagglutinin/esterase cDNA and protein partial sequences are listed in FIGS. (1) to (4), (13) and (14).

Abstract: A new coronavirus is disclosed herein with a tropism that includes humans. Means and methods are provided for diagnosing subjects (previously) infected with the virus. Also provided are among others vaccines, medicaments, nucleic acids and specific binding members.

Abstract: A new coronavirus is disclosed herein with a tropism that includes humans. Means and methods are provided for diagnosing subjects (previously) infected with the virus. Also provided are among others vaccines, medicaments, nucleic acids and specific binding members.

Abstract: The present invention aims to provide a novel CTL epitope peptide of the SARS coronavirus. The present invention provides a peptide having an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 11, 12, 13, 15, 17, 18, 23 and 24.

Abstract: The present invention aims to provide a novel CTL epitope peptide of the SARS coronavirus. The present invention provides a peptide having an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 11, 12, 13, 15, 17, 18, 23 and 24.

Abstract: Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.

Abstract: The present invention provides polynucleotide molecules encoding portions of the S protein from feline infectious peritonitis virus (FIPV). The present invention further provides polynucleotide molecules encoding the entire S protein or portions thereof from feline enteric coronavirus (FECV). The polynucleotide molecules of the present invention are useful as diagnostic reagents.

Abstract: Compositions and methods are provided for potent mRNA vaccines for prevention and treatment of 2019 novel Coronavirus (2019-nCoV) infections. The compositions include a pharmaceutical composition containing one or more mRNA molecules encoding spike protein epitopes, including mutated epitopes, or mRNA cocktails that encode critical viral genes together with pharmaceutically acceptable polymeric nanoparticle carriers and liposomal nanoparticle carriers. Methods for stimulating system immune responses and treatment are provided, including subcutaneous, intraperitoneal and intramuscular injections.

Abstract: The invention relates to the use of proteins and peptides coded by the genome of the isolated or purified strain of severe acute respiratory syndrome (SARS)-associated coronavirus, resulting from sample reference number 031589 and, in particular, to the use of protein S and the derivative antibodies thereof as diagnostic reagents and as a vaccine.

Abstract: The present invention provides a chimaeric coronavirus S protein which is based on an S protein from a coronavirus strain with restricted tissue tropism, but which comprises at least part of the S2 subunit from a coronavirus strain with extended tissue tropism, such that a virus comprising the chimaeric S protein has extended tissue tropism. The present invention also provides a virus comprising such a chimaeric S protein.

Abstract: The invention provides compositions and methods that are useful for preventing and treating a coronavirus infection in a subject. More specifically, the invention provides peptides and conjugates and pharmaceutical compositions containing those peptides and conjugates that block fusion of a coronavirus, such as the SARS virus, to a target cell. This blocking mechanism prevents or treats a coronavirus infection, such as a SARS infection, in a subject, such as a human subject.

Abstract: Isolated polypeptides containing fragments of SARS CoV S protein and functional equivalents thereof. Also disclosed are isolated nucleic acids encoding the polypeptides, related expression vectors, related host cells, related antibodies, and related compositions. Methods of producing the polypeptide, diagnosing infection with a coronavirus, and identifying a test compound for treating infection with a coronavirus are also disclosed.

Abstract: Isolated polypeptides containing fragments of SARS CoV S protein and functional equivalents thereof. Also disclosed are isolated nucleic acids encoding the polypeptides, related expression vectors, related host cells, related antibodies, and related compositions. Methods of producing the polypeptide, diagnosing infection with a coronavirus, and identifying a test compound for treating infection with a coronavirus are also disclosed.

Abstract: Isolated polypeptides containing fragments of SARS CoV S protein and functional equivalents thereof. Also disclosed are isolated nucleic acids encoding the polypeptides, related expression vectors, related host cells, related antibodies, and related compositions. Methods of producing the polypeptide, diagnosing infection with a coronavirus, and identifying a test compound for treating infection with a coronavirus are also disclosed.

Abstract: The present invention is directed to an isolated polypeptide containing SEQ ID NO: 1 or an immunogenic fragment thereof. Also disclosed is an isolated nucleic acid encoding the polypeptide or containing a sequence at least 70% identical to SEQ ID NO: 3. Within the scope of this invention are related expression vectors, host cells, and antibodies. Also disclosed are methods of producing the polypeptide, diagnosing coronavirus infection, and identifying a test compound for treating coronavirus infection.

Abstract: The present invention provides a vaccine or immunogenic composition comprising: an immunogenic SARS coronavirus S (spike) polypeptide, or a fragment or variant thereof; and an adjuvant comprising a lipopolysaccharide, a saponin and a liposome.

Abstract: The present invention provides an immunogenic composition comprising: an immunogenic SARS coronavirus S (spike) polypeptide, or a fragment or variant thereof; and an adjuvant comprising an oil-in-water emulsion.