Search Patents
-
Patent number: 7981427Abstract: A canine respiratory coronavirus (CRCV) that is present in the respiratory tract of dogs with canine infectious respiratory disease and which has a low level of homology to the enteric canine coronavirus, but which has a high level of homology to all bovine coronavirus strains (e.g., Quebec and LY138) and human coronavirus strain OC43.Type: GrantFiled: September 26, 2008Date of Patent: July 19, 2011Assignee: The Royal Veterinary CollegeInventors: John Brownlie, Victoria Jane Chalker, Kerstin Erles
-
Publication number: 20100150923Abstract: Fusion proteins of recombinant SARS coronavirus structural proteins, their production and uses are provided. An optimized SARS coronavirus S protein gene which can be highly expressed in the mammalian cell strains and SARS coronavirus S protein variants comprising deletion, modification or mutation amino acids 318-510 corresponding to SARS coronavirus S protein are also provided.Type: ApplicationFiled: June 13, 2006Publication date: June 17, 2010Applicant: Chinese Academy of Medical Sciences, Institute of Basic Medical SciencesInventors: Chengyu Jiang, Feng Guo, Shuan Rao, Bing Guan, Yi Huan, Peng Yang
-
Publication number: 20140205621Abstract: A new pantropic canine coronavirus (CCoV) strain, having reduced pathogenicity, and capable of eliciting an immune response, is described.Type: ApplicationFiled: June 26, 2012Publication date: July 24, 2014Inventors: Nicola Decaro, Vito Martella, Gabriella Elia, Canio Buonavoglia
-
Patent number: 7776340Abstract: A canine respiratory coronavirus (CRCV) that is present in the respiratory tract of dogs with canine infectious respiratory disease and which has a low level of homology to the enteric canine coronavirus, but which has a high level of homology to all bovine coronavirus strains (eg Quebec and LY138) and human coronavirus strain OC43. The CRCV spike, polymerase and hemagglutinin/esterase cDNA and protein partial sequences are listed in FIGS. (1) to (4), (13) and (14).Type: GrantFiled: July 1, 2003Date of Patent: August 17, 2010Assignee: The Royal Veterinary CollegeInventors: John Brownlie, Victoria Jane Chalker, Kerstin Erles
-
Publication number: 20150050308Abstract: A new coronavirus is disclosed herein with a tropism that includes humans. Means and methods are provided for diagnosing subjects (previously) infected with the virus. Also provided are among others vaccines, medicaments, nucleic acids and specific binding members.Type: ApplicationFiled: August 13, 2014Publication date: February 19, 2015Inventor: Cornelia Maria van der Hoek
-
Patent number: 9945856Abstract: A new coronavirus is disclosed herein with a tropism that includes humans. Means and methods are provided for diagnosing subjects (previously) infected with the virus. Also provided are among others vaccines, medicaments, nucleic acids and specific binding members.Type: GrantFiled: August 13, 2014Date of Patent: April 17, 2018Assignee: AMSTERDAM INSTITUTE OF VIRAL GENOMICS B.V.Inventor: Cornelia Maria van der Hoek
-
Publication number: 20110262529Abstract: The present invention aims to provide a novel CTL epitope peptide of the SARS coronavirus. The present invention provides a peptide having an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 11, 12, 13, 15, 17, 18, 23 and 24.Type: ApplicationFiled: November 27, 2009Publication date: October 27, 2011Applicants: NOF CORPORATION, JAPAN as represented by DIRECTOR-GENERAL of National Institute of Infectious Diseases, SAITAMA MEDICAL UNIVERSITYInventors: Masanori Matsui, Tetsuya Uchida, Hiroshi Oda
-
Patent number: 8828929Abstract: The present invention aims to provide a novel CTL epitope peptide of the SARS coronavirus. The present invention provides a peptide having an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 11, 12, 13, 15, 17, 18, 23 and 24.Type: GrantFiled: November 27, 2009Date of Patent: September 9, 2014Assignees: Nof Corporation, Saitama Medical University, Japan as Represented by Director-General of National Institute of Infectious DiseasesInventors: Masanori Matsui, Tetsuya Uchida, Hiroshi Oda
-
Patent number: 11866461Abstract: Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.Type: GrantFiled: May 16, 2023Date of Patent: January 9, 2024Assignee: KING FAISAL UNIVERSITYInventor: Mahmoud Kandeel
-
Patent number: 6280974Abstract: The present invention provides polynucleotide molecules encoding portions of the S protein from feline infectious peritonitis virus (FIPV). The present invention further provides polynucleotide molecules encoding the entire S protein or portions thereof from feline enteric coronavirus (FECV). The polynucleotide molecules of the present invention are useful as diagnostic reagents.Type: GrantFiled: February 22, 1995Date of Patent: August 28, 2001Assignee: Pfizer IncInventors: Timothy J. Miller, Albert Paul Reed, Sharon R. Klepfer, Nancy E. Pfeiffer, Brian T. Suiter, Elaine V. Jones
-
Publication number: 20120082693Abstract: The invention relates to the use of proteins and peptides coded by the genome of the isolated or purified strain of severe acute respiratory syndrome (SARS)-associated coronavirus, resulting from sample reference number 031589 and, in particular, to the use of protein S and the derivative antibodies thereof as diagnostic reagents and as a vaccine.Type: ApplicationFiled: July 20, 2011Publication date: April 5, 2012Inventors: Sylvie VAN DER WERF, Nicolas Escriou, Bernadette Crescenzo-Chaigne, Jean-Claude Manuguerra, Frederik Kunst, Benoît Callendret, Jean-Michel Betton, Valérie Lorin, Sylvie Gerbaud, Ana Maria Burguiere, Saliha Azebi, Pierre Charneau, Frédéric Tangy, Chantal Combredet, Jean-François Delagneau, Monique Martin
-
Patent number: 7151163Abstract: The invention provides compositions and methods that are useful for preventing and treating a coronavirus infection in a subject. More specifically, the invention provides peptides and conjugates and pharmaceutical compositions containing those peptides and conjugates that block fusion of a coronavirus, such as the SARS virus, to a target cell. This blocking mechanism prevents or treats a coronavirus infection, such as a SARS infection, in a subject, such as a human subject.Type: GrantFiled: April 28, 2004Date of Patent: December 19, 2006Assignee: Sequoia Pharmaceuticals, Inc.Inventors: John W. Erickson, Abelardo Silva
-
Publication number: 20120177675Abstract: The present invention provides a chimaeric coronavirus S protein which is based on an S protein from a coronavirus strain with restricted tissue tropism, but which comprises at least part of the S2 subunit from a coronavirus strain with extended tissue tropism, such that a virus comprising the chimaeric S protein has extended tissue tropism. The present invention also provides a virus comprising such a chimaeric S protein.Type: ApplicationFiled: July 5, 2010Publication date: July 12, 2012Applicant: INSTITUTE FOR ANIMAL HEALTHInventors: Paul Britton, Erica Bickerton, Maria Armesto
-
Publication number: 20090022735Abstract: Isolated polypeptides containing fragments of SARS CoV S protein and functional equivalents thereof. Also disclosed are isolated nucleic acids encoding the polypeptides, related expression vectors, related host cells, related antibodies, and related compositions. Methods of producing the polypeptide, diagnosing infection with a coronavirus, and identifying a test compound for treating infection with a coronavirus are also disclosed.Type: ApplicationFiled: July 28, 2008Publication date: January 22, 2009Applicant: National Health Research InstitutesInventors: Pele Choi Sing Chong, Shie-Liang Hsieh
-
Publication number: 20080213284Abstract: Isolated polypeptides containing fragments of SARS CoV S protein and functional equivalents thereof. Also disclosed are isolated nucleic acids encoding the polypeptides, related expression vectors, related host cells, related antibodies, and related compositions. Methods of producing the polypeptide, diagnosing infection with a coronavirus, and identifying a test compound for treating infection with a coronavirus are also disclosed.Type: ApplicationFiled: January 10, 2005Publication date: September 4, 2008Inventors: Pele Choi Sing Chong, Shie-Liang Hsieh
-
Patent number: 7491397Abstract: Isolated polypeptides containing fragments of SARS CoV S protein and functional equivalents thereof. Also disclosed are isolated nucleic acids encoding the polypeptides, related expression vectors, related host cells, related antibodies, and related compositions. Methods of producing the polypeptide, diagnosing infection with a coronavirus, and identifying a test compound for treating infection with a coronavirus are also disclosed.Type: GrantFiled: January 10, 2005Date of Patent: February 17, 2009Assignee: National Health Research InstitutesInventors: Pele Choi Sing Chong, Shie-Liang Hsieh
-
Patent number: 7691390Abstract: The present invention is directed to an isolated polypeptide containing SEQ ID NO: 1 or an immunogenic fragment thereof. Also disclosed is an isolated nucleic acid encoding the polypeptide or containing a sequence at least 70% identical to SEQ ID NO: 3. Within the scope of this invention are related expression vectors, host cells, and antibodies. Also disclosed are methods of producing the polypeptide, diagnosing coronavirus infection, and identifying a test compound for treating coronavirus infection.Type: GrantFiled: September 19, 2007Date of Patent: April 6, 2010Inventors: Fang-Jen Lee, Chia-Jung Yu, Ming-Fu Chang, Hong-Nerng Ho
-
Publication number: 20120045469Abstract: The present invention provides an immunogenic composition comprising: an immunogenic SARS coronavirus S (spike) polypeptide, or a fragment or variant thereof; and an adjuvant comprising an oil-in-water emulsion.Type: ApplicationFiled: December 1, 2009Publication date: February 23, 2012Applicant: GlaxoSmithKline Biologicals S.A.Inventors: Benoit Baras, Benoit Callendret, Nicolas Escriou, Valerie Lorin, Philippe Marianneau, Sylvie Van Der Werf, Martine Anne Cecile Wettendorff
-
Publication number: 20100233250Abstract: The present invention provides a vaccine or immunogenic composition comprising: an immunogenic SARS coronavirus S (spike) polypeptide, or a fragment or variant thereof; and an adjuvant comprising a lipopolysaccharide, a saponin and a liposome.Type: ApplicationFiled: June 20, 2008Publication date: September 16, 2010Inventors: Benoit Baras, Benoit Callendret, Nicolas Escriou, Valerie Lorin, Philippe Marianneau, Sylvie Van Der Werf, Martine Anne Cecile Wettendorff
-
Patent number: 6602504Abstract: The present invention provides the amino acid and nucleotide sequences of a CCV spike gene, and compositions containing one or more fragments of the spike gene and encoded polypeptide for prophylaxis, diagnostic purposes and treatment of CCV infections.Type: GrantFiled: October 5, 2001Date of Patent: August 5, 2003Assignee: Pfizer Inc.Inventors: Timothy J. Miller, Sharon Klepfer, Albert Paul Reed, Elaine V. Jones