Search Patents
  • Canine respiratory coronavirus (CRCV) spike protein
    Patent number: 7981427
    Abstract: A canine respiratory coronavirus (CRCV) that is present in the respiratory tract of dogs with canine infectious respiratory disease and which has a low level of homology to the enteric canine coronavirus, but which has a high level of homology to all bovine coronavirus strains (e.g., Quebec and LY138) and human coronavirus strain OC43.
    Type: Grant
    Filed: September 26, 2008
    Date of Patent: July 19, 2011
    Assignee: The Royal Veterinary College
    Inventors: John Brownlie, Victoria Jane Chalker, Kerstin Erles
  • FUSION PROTEINS OF RECOMBINANT SARS CORONAVIRUS STRUCTURAL PROTEINS, THEIR PRODUCTION AND USES
    Publication number: 20100150923
    Abstract: Fusion proteins of recombinant SARS coronavirus structural proteins, their production and uses are provided. An optimized SARS coronavirus S protein gene which can be highly expressed in the mammalian cell strains and SARS coronavirus S protein variants comprising deletion, modification or mutation amino acids 318-510 corresponding to SARS coronavirus S protein are also provided.
    Type: Application
    Filed: June 13, 2006
    Publication date: June 17, 2010
    Applicant: Chinese Academy of Medical Sciences, Institute of Basic Medical Sciences
    Inventors: Chengyu Jiang, Feng Guo, Shuan Rao, Bing Guan, Yi Huan, Peng Yang
  • CANINE CORONAVIRUS VACCINE
    Publication number: 20140205621
    Abstract: A new pantropic canine coronavirus (CCoV) strain, having reduced pathogenicity, and capable of eliciting an immune response, is described.
    Type: Application
    Filed: June 26, 2012
    Publication date: July 24, 2014
    Inventors: Nicola Decaro, Vito Martella, Gabriella Elia, Canio Buonavoglia
  • Canine respiratory coronavirus (CRCV) spike protein, polymerase and hemagglutinin/esterase
    Patent number: 7776340
    Abstract: A canine respiratory coronavirus (CRCV) that is present in the respiratory tract of dogs with canine infectious respiratory disease and which has a low level of homology to the enteric canine coronavirus, but which has a high level of homology to all bovine coronavirus strains (eg Quebec and LY138) and human coronavirus strain OC43. The CRCV spike, polymerase and hemagglutinin/esterase cDNA and protein partial sequences are listed in FIGS. (1) to (4), (13) and (14).
    Type: Grant
    Filed: July 1, 2003
    Date of Patent: August 17, 2010
    Assignee: The Royal Veterinary College
    Inventors: John Brownlie, Victoria Jane Chalker, Kerstin Erles
  • CORONAVIRUS, NUCLEIC ACID, PROTEIN, AND METHODS FOR THE GENERATION OF VACCINE, MEDICAMENTS AND DIAGNOSTICS
    Publication number: 20150050308
    Abstract: A new coronavirus is disclosed herein with a tropism that includes humans. Means and methods are provided for diagnosing subjects (previously) infected with the virus. Also provided are among others vaccines, medicaments, nucleic acids and specific binding members.
    Type: Application
    Filed: August 13, 2014
    Publication date: February 19, 2015
    Inventor: Cornelia Maria van der Hoek
  • Coronavirus, nucleic acid, protein, and methods for the generation of vaccine, medicaments and diagnostics
    Patent number: 9945856
    Abstract: A new coronavirus is disclosed herein with a tropism that includes humans. Means and methods are provided for diagnosing subjects (previously) infected with the virus. Also provided are among others vaccines, medicaments, nucleic acids and specific binding members.
    Type: Grant
    Filed: August 13, 2014
    Date of Patent: April 17, 2018
    Assignee: AMSTERDAM INSTITUTE OF VIRAL GENOMICS B.V.
    Inventor: Cornelia Maria van der Hoek
  • CYTOTOXIC T CELL EPITOPE PEPTIDE FOR SARS CORONAVIRUS, AND USE THEREOF
    Publication number: 20110262529
    Abstract: The present invention aims to provide a novel CTL epitope peptide of the SARS coronavirus. The present invention provides a peptide having an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 11, 12, 13, 15, 17, 18, 23 and 24.
    Type: Application
    Filed: November 27, 2009
    Publication date: October 27, 2011
    Applicants: NOF CORPORATION, JAPAN as represented by DIRECTOR-GENERAL of National Institute of Infectious Diseases, SAITAMA MEDICAL UNIVERSITY
    Inventors: Masanori Matsui, Tetsuya Uchida, Hiroshi Oda
  • Cytotoxic T cell epitope peptide for SARS coronavirus, and use thereof
    Patent number: 8828929
    Abstract: The present invention aims to provide a novel CTL epitope peptide of the SARS coronavirus. The present invention provides a peptide having an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 11, 12, 13, 15, 17, 18, 23 and 24.
    Type: Grant
    Filed: November 27, 2009
    Date of Patent: September 9, 2014
    Assignees: Nof Corporation, Saitama Medical University, Japan as Represented by Director-General of National Institute of Infectious Diseases
    Inventors: Masanori Matsui, Tetsuya Uchida, Hiroshi Oda
  • Fusion peptide inhibitors of human coronavirus 229E
    Patent number: 11866461
    Abstract: Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.
    Type: Grant
    Filed: May 16, 2023
    Date of Patent: January 9, 2024
    Assignee: KING FAISAL UNIVERSITY
    Inventor: Mahmoud Kandeel
  • Recombinant feline coronavirus S proteins
    Patent number: 6280974
    Abstract: The present invention provides polynucleotide molecules encoding portions of the S protein from feline infectious peritonitis virus (FIPV). The present invention further provides polynucleotide molecules encoding the entire S protein or portions thereof from feline enteric coronavirus (FECV). The polynucleotide molecules of the present invention are useful as diagnostic reagents.
    Type: Grant
    Filed: February 22, 1995
    Date of Patent: August 28, 2001
    Assignee: Pfizer Inc
    Inventors: Timothy J. Miller, Albert Paul Reed, Sharon R. Klepfer, Nancy E. Pfeiffer, Brian T. Suiter, Elaine V. Jones
  • USE OF PROTEINS AND PEPTIDES ENCODED BY THE GENOME OF A NOVEL SARS-ASSOCIATED CORONAVIRUS STRAIN
    Publication number: 20120082693
    Abstract: The invention relates to the use of proteins and peptides coded by the genome of the isolated or purified strain of severe acute respiratory syndrome (SARS)-associated coronavirus, resulting from sample reference number 031589 and, in particular, to the use of protein S and the derivative antibodies thereof as diagnostic reagents and as a vaccine.
    Type: Application
    Filed: July 20, 2011
    Publication date: April 5, 2012
    Inventors: Sylvie VAN DER WERF, Nicolas Escriou, Bernadette Crescenzo-Chaigne, Jean-Claude Manuguerra, Frederik Kunst, Benoît Callendret, Jean-Michel Betton, Valérie Lorin, Sylvie Gerbaud, Ana Maria Burguiere, Saliha Azebi, Pierre Charneau, Frédéric Tangy, Chantal Combredet, Jean-François Delagneau, Monique Martin
  • Antiviral agents for the treatment, control and prevention of infections by coronaviruses
    Patent number: 7151163
    Abstract: The invention provides compositions and methods that are useful for preventing and treating a coronavirus infection in a subject. More specifically, the invention provides peptides and conjugates and pharmaceutical compositions containing those peptides and conjugates that block fusion of a coronavirus, such as the SARS virus, to a target cell. This blocking mechanism prevents or treats a coronavirus infection, such as a SARS infection, in a subject, such as a human subject.
    Type: Grant
    Filed: April 28, 2004
    Date of Patent: December 19, 2006
    Assignee: Sequoia Pharmaceuticals, Inc.
    Inventors: John W. Erickson, Abelardo Silva
  • Chimaeric Protein
    Publication number: 20120177675
    Abstract: The present invention provides a chimaeric coronavirus S protein which is based on an S protein from a coronavirus strain with restricted tissue tropism, but which comprises at least part of the S2 subunit from a coronavirus strain with extended tissue tropism, such that a virus comprising the chimaeric S protein has extended tissue tropism. The present invention also provides a virus comprising such a chimaeric S protein.
    Type: Application
    Filed: July 5, 2010
    Publication date: July 12, 2012
    Applicant: INSTITUTE FOR ANIMAL HEALTH
    Inventors: Paul Britton, Erica Bickerton, Maria Armesto
  • Receptor Binding Polypeptides
    Publication number: 20090022735
    Abstract: Isolated polypeptides containing fragments of SARS CoV S protein and functional equivalents thereof. Also disclosed are isolated nucleic acids encoding the polypeptides, related expression vectors, related host cells, related antibodies, and related compositions. Methods of producing the polypeptide, diagnosing infection with a coronavirus, and identifying a test compound for treating infection with a coronavirus are also disclosed.
    Type: Application
    Filed: July 28, 2008
    Publication date: January 22, 2009
    Applicant: National Health Research Institutes
    Inventors: Pele Choi Sing Chong, Shie-Liang Hsieh
  • RECEPTOR BINDING POLYPEPTIDES
    Publication number: 20080213284
    Abstract: Isolated polypeptides containing fragments of SARS CoV S protein and functional equivalents thereof. Also disclosed are isolated nucleic acids encoding the polypeptides, related expression vectors, related host cells, related antibodies, and related compositions. Methods of producing the polypeptide, diagnosing infection with a coronavirus, and identifying a test compound for treating infection with a coronavirus are also disclosed.
    Type: Application
    Filed: January 10, 2005
    Publication date: September 4, 2008
    Inventors: Pele Choi Sing Chong, Shie-Liang Hsieh
  • Receptor binding polypeptides
    Patent number: 7491397
    Abstract: Isolated polypeptides containing fragments of SARS CoV S protein and functional equivalents thereof. Also disclosed are isolated nucleic acids encoding the polypeptides, related expression vectors, related host cells, related antibodies, and related compositions. Methods of producing the polypeptide, diagnosing infection with a coronavirus, and identifying a test compound for treating infection with a coronavirus are also disclosed.
    Type: Grant
    Filed: January 10, 2005
    Date of Patent: February 17, 2009
    Assignee: National Health Research Institutes
    Inventors: Pele Choi Sing Chong, Shie-Liang Hsieh
  • Viral protein
    Patent number: 7691390
    Abstract: The present invention is directed to an isolated polypeptide containing SEQ ID NO: 1 or an immunogenic fragment thereof. Also disclosed is an isolated nucleic acid encoding the polypeptide or containing a sequence at least 70% identical to SEQ ID NO: 3. Within the scope of this invention are related expression vectors, host cells, and antibodies. Also disclosed are methods of producing the polypeptide, diagnosing coronavirus infection, and identifying a test compound for treating coronavirus infection.
    Type: Grant
    Filed: September 19, 2007
    Date of Patent: April 6, 2010
    Inventors: Fang-Jen Lee, Chia-Jung Yu, Ming-Fu Chang, Hong-Nerng Ho
  • VACCINE
    Publication number: 20120045469
    Abstract: The present invention provides an immunogenic composition comprising: an immunogenic SARS coronavirus S (spike) polypeptide, or a fragment or variant thereof; and an adjuvant comprising an oil-in-water emulsion.
    Type: Application
    Filed: December 1, 2009
    Publication date: February 23, 2012
    Applicant: GlaxoSmithKline Biologicals S.A.
    Inventors: Benoit Baras, Benoit Callendret, Nicolas Escriou, Valerie Lorin, Philippe Marianneau, Sylvie Van Der Werf, Martine Anne Cecile Wettendorff
  • VACCINE
    Publication number: 20100233250
    Abstract: The present invention provides a vaccine or immunogenic composition comprising: an immunogenic SARS coronavirus S (spike) polypeptide, or a fragment or variant thereof; and an adjuvant comprising a lipopolysaccharide, a saponin and a liposome.
    Type: Application
    Filed: June 20, 2008
    Publication date: September 16, 2010
    Inventors: Benoit Baras, Benoit Callendret, Nicolas Escriou, Valerie Lorin, Philippe Marianneau, Sylvie Van Der Werf, Martine Anne Cecile Wettendorff
  • Canine coronavirus S gene and uses therefor
    Patent number: 6602504
    Abstract: The present invention provides the amino acid and nucleotide sequences of a CCV spike gene, and compositions containing one or more fragments of the spike gene and encoded polypeptide for prophylaxis, diagnostic purposes and treatment of CCV infections.
    Type: Grant
    Filed: October 5, 2001
    Date of Patent: August 5, 2003
    Assignee: Pfizer Inc.
    Inventors: Timothy J. Miller, Sharon Klepfer, Albert Paul Reed, Elaine V. Jones