Abstract: The present invention relates to a conjugated compound comprising a marker M pharmaceutically acceptable, and a peptide or pseudo-peptide P having at most 30 amino acid residues and able to bind the Low-Density Lipoprotein Receptor (LDLR) and to its use in a method of labelling and/or detecting and/or treating cancerous cells in a subject by administration of the conjugated compound to the subject an analysis of the presence and/or the amount of marker.

Abstract: The invention relates to Variable Domain of Camelid Heavy Chain-only (VHH) molecules which bind TfR, conjugate compounds comprising such VHH molecules, and the uses thereof e.g., to transport molecules of pharmaceutical or diagnostic interest into cells and in organs, in pathological conditions including cancer.

Abstract: The present invention relates to a conjugated compound comprising a marker M pharmaceutically acceptable, and a peptide or pseudo-peptide P having at most 30 amino acid residues and able to bind the Low-Density Lipoprotein Receptor (LDLR) and to its use in a method of labelling and/or detecting and/or treating cancerous cells in a subject by administration of the conjugated compound to the subject an analysis of the presence and/or the amount of marker.

Abstract: The present invention relates to a conjugated compound comprising a marker M pharmaceutically acceptable, and a peptide or pseudo-peptide P having at most 30 amino acid residues and able to bind the Low-Density Lipoprotein Receptor (LDLR) and to its use in a method of labelling and/or detecting and/or treating cancerous cells in a subject by administration of the conjugated compound to the subject an analysis of the presence and/or the amount of marker.

Abstract: A PAT nonapeptide of formula EAKSQGGSD (SEQ ID NO: 1) can be used to treat or prevent neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, Huntington's disease and amyotrophic lateral sclerosis. Pharmaceutical compositions containing the PAT nonapeptide can be formulated for administration by parenteral route, including the subcutaneous, intraperitoneal, intravenous or intranasal routes.

Abstract: The invention refers to the use of the PAT nonapeptide which is a thymuline analog in the treatment of autoimmune diseases, in particular of rheumatoid arthritis and intestinal bowel diseases (IBD) such as the Crohn's disease.

Abstract: A PAT nonapeptide of formula EAKSQGGSD can be used to treat or prevent neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, Huntington's disease and amyotrophic lateral sclerosis. Pharmaceutical compositions containing the PAT nonapeptide can be formulated for administration by parenteral route, including the subcutaneous, intraperitoneal, intravenous or intranasal routes.

Abstract: The invention relates to the use of the PAT nonapeptide in the manufacture of a drug for preventing or treating a neurodegenerative disease such as Alzheimer's disease. The parenteral route of administration is preferable, including the subcutaneous, intraperitoneal, intravenous or intranasal routes. The invention also relates to an injectable formulation containing the PAT nonapeptide which can be administered to patients suffering from a neurodegenerative disease such as Alzheimer's disease.

Abstract: The invention relates to the use of the PAT nonapeptide in the manufacture of a drug for preventing or treating a neurodegenerative disease such as Alzheimer's disease. The parenteral route of administration is preferable, including the subcutaneous, intraperitoneal, intravenous or intranasal routes. The invention also relates to an injectable formulation containing the PAT nonapeptide which can be administered to patients suffering from a neurodegenerative disease such as Alzheimer's disease.

Abstract: The invention refers to the use of the PAT nonapeptide which is a thymuline analog in the treatment of autoimmune diseases, in particular of rheumatoid arthritis and intestinal bowel diseases (IBD) such as the Crohn's disease.

Abstract: The invention concerns a pharmaceutical composition for treating and/or preventing cancer comprising at least an anti-cancer agent, characterised in that said anticancer agent is associated in the composition with at least a peptide capable of carrying said agent into the cancer cells and prevent the occurrence of chemoresistance to said agent.

Abstract: The invention concerns the use of a linear peptide paired with an active substance for diagnosing or treating a CNS pathology by preparing a medicine capable of crossing the blood brain barrier to be used for diagnosis or treatment of a pathology localized in the CNS.

Abstract: The invention relates to novel derivatives of morphine-6-glucuronide, the preparation method thereof and the uses of same in therapy, for example, as analgesics.

Abstract: The invention relates to conjugates of an antigen coupled to a linear derivative of a ?-stranded antibiotic peptide, which are useful for immunogenic agents to enhance a CTL response. Two groups of preferred peptides are derived from the antibiotics protegrin and tachyplesin.

Abstract: A peptide molecule that interferes with an HLH domain of TAL-1 including at least 10 successive amino acids from the HLH domain of TAL-1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1) or an equivalent sequence; and a pharmaceutical composition comprising at least one peptide molecule as an active ingredient, and an acceptable vehicle.

Abstract: The invention relates to novel derivatives of morphine-6-glucuronide, the preparation method thereof and the uses of same in therapy, for example, as analgesics.

Abstract: Taxoid derivatives are used in the treatment of cancers, particular cancers of the central nervous system, such as brain cancers. Taxoid derivatives are transported across the blood/brain barrier (BBB). A compound is provided which consists of at least one taxoid derivative bound to at least one vector peptide capable of increasing the solubility of the derivative and advantageously allowing it to be transported across the BBB.

Abstract: A pharmaceutical composition including at least one therapeutic molecule effective for treating lung cancers or pulmonary diseases; and at least one peptide vector that augments bioavailability of the molecule in a patient's lungs selected from the group consisting of Ala-Trp-Ser-Phe-Arg-Val-Ser-Tyr-Arg-Gly-Ile-Ser-Tyr-Arg-Arg-Ser-Arg (SynB4) (SEQ ID No. 1), and Arg-GLy-Gly-Arg-Leu-Ser-Tyr-Ser-Cit-Cit-Cit-Phe-Ser-Thr-Ser-Thr-Gly-Arg (SynB6) (SEQ ID No. 2).

Abstract: The invention relates to conjugates of an antigen coupled to a linear derivative of a &bgr;-stranded antibiotic peptide, which are useful for immunogenic agents to enhance a CTL response. Two groups of preferred peptides are derived from the antibiotics protegrin and tachyplesin.

Abstract: The present invention provides a method of reducing the immunostimulatory effects of certain phosphorothioate oligonucleotides used to treat pathogen-mediated disease states and other medical conditions. Immunostimulatory effects of phosphorothioate oligonucleotides are reduced in accordance with the method of the invention by administering the phosphorothioate oligonucleotide in a therapeutic formulation which includes at least one cyclodextrin to a mammal afflicted with the disease or condition being treated. The immune response of the mammal is also monitored in the method of the invention.