Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ?ID?1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ?ID?2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ?ID?3 DLIFLARSALILRGSVAHKSC SEQ?ID?4 PGIADIEDLTLLARSMVVVRP SEQ?ID?5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ?ID?6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.

Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide has one or more sequences having at least 60% homology with any of SEQ ID 1-6, or has two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3 DLIFLARSALILRGSVAHKSC SEQ ID 4 PGIADIEDLTLLARSMVVVRP SEQ ID 5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.

Abstract: A composition comprising liposomes associated with a nucleic acid operatively encoding an antigenic protein and with an assistor protein, wherein the assistor protein shares at least one epitope with the antigenic protein, and wherein the nucleic acid and said assistor protein are associated with the same liposomes is described. The composition provides an improved immune response compared to mixtures of liposomes some of which are associated with the nucleic acid and some of which are associated with the assistor protein.

Abstract: A composition comprising liposomes associated with a nucleic acid operatively encoding an antigenic protein and with an assistor protein, wherein the assistor protein shares at least one epitope with the antigenic protein, and wherein the nucleic acid and said assistor protein are associated with the same liposomes is described. The composition provides an improved immune response compared to mixtures of liposomes some of which are associated with the nucleic acid and some of which are associated with the assistor protein.

Abstract: Provided is a polypeptide composition comprising one or more polypeptides, which polypeptides are immunogenic in a vertebrate such that they cause the vertebrate to produce immune system cells capable of recognising at least one epitope from an arthropod saliva protein fraction, wherein the arthropod saliva protein fraction has a mass of 40 kDA or less, and wherein the polypeptides are selected independently from: the polypeptide sequences of SEQ ID 1-44 or sub-sequences from these sequences, the sub-sequences having 7 amino acids or more; or from polypeptide sequences having 85% homology or more with one or more of the above sequences and contained in one or more of the following databases: GenBank, Protein Data Bank (PDB), SwissProt, Protein Information Resource (PIR), Protein Research Foundation (PRF), or CDS translations of these.

Abstract: Provided is a compound comprising: (a) a first component capable of binding to ER+ cell receptors; and (b) a second component; wherein the second component is a ribosome inactivating toxin and is conjugated to the first component.

Abstract: A composition comprising liposomes associated with a nucleic acid operatively encoding an antigenic protein and with an assistor protein, wherein the assistor protein shares at least one epitope with the antigenic protein, and wherein the nucleic acid and said assistor protein are associated with the same liposomes is described. The composition provides an improved immune response compared to mixtures of liposomes some of which are associated with the nucleic acid and some of which are associated with the assistor protein.

Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3 DLIFLARSALILRGSVAHKSC SEQ ID 4 PGIADIEDLTLLARSMVVVRP SEQ ID 5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.

Abstract: A composition for the co-delivery to a cell of a nucleic acid and an assistor protein, comprising vesicles, nucleic acid and protein, wherein the nucleic acid operatively encodes an antigenic protein or portion thereof which shares at least one epitope with the assistor protein, the composition comprising said nucleic acid and said assistor protein associated with the same vesicles as one another. A preferred embodiment is a composition comprising liposomes formed from liposome forming materials and, associated with the liposomes, nucleic acid operatively encoding an antigenic protein and an assistor protein, wherein the assistor protein shares at least one epitope with the antigenic protein. The composition is for use as a vaccine and provides improved immune response compared to non-vesicular compositions, or mixtures of liposomes some of which are associated with nucleic acid and some of which are associated with assistor protein.