Abstract: A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Abstract: Methods for reprogramming cells by culturing the cells under a condition that allows formation of a three-dimensional cell aggregate are provided. The cells and cell aggregates obtained using the methods are also provided.

Abstract: The disclosure provides a cell culture system and a serum-free method for cultivating cells. The cell culture system includes a substratum, wherein the substratum has a surface. A polymer is disposed on the surface of the substratum, wherein the polymer is prepared by polymerizing a first monomer with a second monomer. The first monomer has a structure as represented by Formula (I), and the second monomer has a structure as represented by Formula (II): wherein, R1 is hydrogen or methyl; R2 is methyl, ethyl, or —CH2CH2OCH3; R3 is hydrogen or methyl; and, R4 is hydrogen, —CH2CH2OCOCHCHCOOH, —CH2CH2OCOCH2CH2COOH, or —CH2CH2COOH.

Abstract: The present invention provides a method for producing iPS cells, comprising reacting cells with at least one connexin inhibitor and at least one TGF? signaling inhibitor; iPS cells comprising at least one connexin inhibitor; an iPS cell inducer comprising at least one inhibitor selected from the group consisting of connexin inhibitors and TGF? signaling inhibitors; a medium for inducing iPS cells, comprising at least one inhibitor selected from the group consisting of connexin inhibitors and TGF? signaling inhibitors; and a kit for inducing iPS cells, comprising at least one inhibitor selected from the group consisting of connexin inhibitors and TGF? signaling inhibitors.

Abstract: The present invention relates to a method for selective cell attachment/detachment, cell patternization and cell harvesting by means of near infrared rays. More particularly, conducting polymers or metal oxides having exothermic characteristics upon irradiation of near infrared light is used as a cell culture scaffold, thus selectively attaching/detaching cells without an enzyme treatment. The scaffold has an effect of promoting proliferation or differentiation of stem cells, and therefore, can be used as a stem cell culture scaffold. The scaffold enables cell attachment/detachment without temporal or spatial restrictions, thus enabling cell patternization.

Abstract: The present disclosure is directed to the development of compositions, such as extracellular matrices, and processes for using the same, that both maintain stem cells in vitro pluripotency and enable self-renewal. In this regard, it has been discovered that when pluripotent mouse and human embryonic stem cells are cultured on plates coated with recombinant laminin-10 (laminin-511) or their functional domains, in the absence of differentiation inhibitors or feeder cells, the embryonic stem cells proliferated and maintained their pluripotency.

Abstract: This disclosure provides an improved system for culturing human pluripotent stem cells. Traditionally, pluripotent stem cells are cultured on a layer of feeder cells (such as mouse embryonic fibroblasts) to prevent them from differentiating. In the system described here, the role of feeder cells is replaced by components added to the culture environment that support rapid proliferation without differentiation. Effective features are a suitable support structure for the cells, and an effective medium that can be added fresh to the culture without being preconditioned by another cell type. Culturing human embryonic stem cells in fresh medium according to this invention causes the cells to expand surprisingly rapidly, while retaining the ability to differentiate into cells representing all three embryonic germ layers. This new culture system allows for bulk proliferation of pPS cells for commercial production of important products for use in drug screening and human therapy.

Abstract: Methods for forming cell arrays of multiple cell samples arranged substantially in a monolayer on a single substrate particularly suited for diagnostic analysis are disclosed. The cell arrays are formed with a high-speed dispensing apparatus capable of dispensing small volumes in precise, complex patterns. Also disclosed are substrates upon which cell arrays may be formed, and methods for conducting diagnostic analyzes on the formed cell arrays.

Abstract: In one aspect, there is provided a cell culturing substrate including: a cell culture surface having a film attached thereto, wherein the film includes one or more plasma polymerized monomers; and a coating on the film-coated surface, the coating deposited from a coating solution comprising one or more extracellular matrix proteins and an aqueous solvent, where the total extracellular matrix protein concentration in the coating solution is about 1 ng/mL to about 1 mg/mL.

Abstract: The present invention relates generally to the field of tissue engineering and in particular to the production of tissue films or cell matrices, which can be used as a living tissue substitute or an artificial tissue construct in tissue repair or replacement.

Abstract: Described is a scaffold that is strong enough to resist forces that exist inside a body, while possessing biocompatible surfaces. The scaffold is formed of a layer of mesh (e.g., Stainless Steel or Nitinol) that is tightly enclosed by a multi-layer biological matrix. The biological matrix can include three layers, such a first layer (smooth muscle cells) formed directly on the metal mesh, a second layer (fibroblast/myofibroblast cells) formed on the first layer, and a third layer (endothelial cells) formed on the second layer. The scaffold can be formed to operate as a variety of tissues, such as a heart valve or a vascular graft. For example, the mesh and corresponding biological matrix can be formed as leaflets, such that the scaffold is operable as a tissue heart valve.

Abstract: A device that includes a scaffold composition and a bioactive composition with the bioactive composition being incorporated into or coated onto the scaffold composition such that the scaffold composition and/or a bioactive composition controls egress of a resident cell or progeny thereof. The devices mediate active recruitment, modification, and release of host cells from the material.

Abstract: A highly tunable bioscaffold is provided, as well as a method of manufacture of the bioscaffold and methods of use of the bioscaffold, for example for drug testing, cell propagation and for optimizing growth of a cell type, for example corneal endothelial cells.

Abstract: The invention relates to methods of preparing a bone matrix solution, a bone matrix implant, and variants thereof. The invention also relates to methods of cell culture using the same. The invention further relates to bone matrix scaffolds comprising one or more bone matrix nanofibers, methods of preparing, and methods of use thereof. The invention also relates to methods of culturing cells and promoting differentiation of stem cells using the same.

Abstract: The present invention relates to a simplified process, which is shorter in time, for propagation of proliferating cells, such as e.g. progenitor or stem cells, by means of a biphasic culturing system having a differentiation supporting component and a proliferation supporting component, and to the use of the stem cell cultures obtained in this way for cell therapy purposes. The present invention invention describes a method, which is highly efficient to prime stem or progenitor cells to differentiation using non-attachment matrices and differentiation supporting component. The cells produced therefrom may be used to treat a variety of neurodegenerative disorders.

Abstract: Methods for treating surfaces of polymeric substrates (as used in medical implants) with inert plasmas to promote the growth of bioentities (such as cells) on these surfaces is disclosed. The treated surfaces are subsequently exposed to an environment to form functionalities associated with enhanced growth of the bioentity on the surface. For example, the substrate may be exposed to the ambient environment. The bioentity may then be deposited on the modified surface. This inert plasma treatment and exposure to a suitable environment does not degrade the implants, and thus improved implants are created. Also, due to the specific functional groups at the modified surface, high cell densities are achieved.

Abstract: In one aspect, there is provided a cell culturing substrate including: a cell culture surface having a film attached thereto, wherein the film includes one or more plasma polymerized monomers; and a coating on the film-coated surface, the coating deposited from a coating solution comprising one or more extracellular matrix proteins and an aqueous solvent, where the total extracellular matrix protein concentration in the coating solution is about 1 ng/mL to about 1 mg/mL.

Abstract: The present invention is directed to polyarylates comprising repeating units having the structure: as well as their preparation and use as cell growth substrates.

Abstract: A porous, collagen coated, ferromagnetic cell culture microcarrier, which is suitable for in vitro cell and tissue culture and which facilitates 3D multicellular construct generation. Also provided is a method for creating batches of microcarriers which have inserted within them magnetite (Fe3O4) in the presence of collagen, thus creating a microcarrier which becomes magnetic in nature when placed in a the presence of a magnetic field and which facilitates cellular adherence (via the collagen coating) for 3D construct development.

Abstract: A masking member contains parallel through-holes, each of the through-holes contains a tilted wall structure; an upper end of the tilted wall structure of one of the through-holes abuts on an upper end of the tilted wall structure of an adjacent one of the through-holes thereby forming a knife-edge ridge at the upper ends. The masking member may in contact with a substrate. Formation in quantity of various different populations of a substance being studied with multiple combinations of distribution form and distribution density may be conducted by dripping a suspension of a single concentration of the substance onto the masking member.

Abstract: A carrier for expansion of induced pluripotent stem cells is provided, wherein the carrier comprises a substrate comprising one or more outer surfaces, wherein the one or more outer surfaces are modified with gas plasma treatment, and one or more structured indentations on one or more of the outer surfaces. The carrier has a length at least about 0.2 mm, a width at least about 0.2 mm, and a height in a range from about 0.05 mm to 1.2 mm and each of the structured indentations has a major axis in a range from about 0.1 mm to 0.5 mm, a minor axis in a range from about 0.1 mm to 0.5 mm and a depth in a range from about 0.025 mm to about 0.5 mm. A method of making the carrier, and culturing induced pluripotent stem cells using the same carrier are also provided.

Abstract: A method for forming a nerve graft includes the following steps. A carbon nanotube structure is provided. A hydrophilic layer is formed on a surface of the carbon nanotube structure. The hydrophilic layer is polarized to form a polar surface on the hydrophilic layer. A number of neurons are formed on the polar surface of the hydrophilic layer to form a nerve network. The neurons connect with each other.

Abstract: A method for forming a culture medium includes the following steps. A carbon nanotube structure is provided. A hydrophilic layer is formed on a surface of the carbon nanotube structure. The hydrophilic layer is polarized to form a polar surface on the hydrophilic layer. A number of neurons are formed on the polar surface of the hydrophilic layer.

Abstract: Described is a scaffold that is strong enough to resist forces that exist inside a body, while possessing biocompatible surfaces. The scaffold is formed of a layer of mesh (e.g., Stainless Steel or Nitinol) that is tightly enclosed by a multi-layer biological matrix. The biological matrix can include three layers, such a first layer (smooth muscle cells) formed directly on the metal mesh, a second layer (fibroblast/myofibroblast cells) formed on the first layer, and a third layer (endothelial cells) formed on the second layer. The scaffold can be formed to operate as a variety of tissues, such as a heart valve or a vascular graft. For example, the mesh and corresponding biological matrix can be formed as leaflets, such that the scaffold is operable as a tissue heart valve.

Abstract: The present invention relates to a biomedical implant for use in a fluid shear stress environment of a subject. The biomedical implant of the present invention includes a patterned surface having a plurality of cellular niches. The cellular niches of the patterned surface are effective to maintain at least one localized layer of living cells within the plurality of cellular niches by decreasing fluid shear stress within the cellular niches as compared to fluid shear stress measured outside of the cellular niches, with the fluid shear stress measured outside of the cellular niches having a peak fluid shear stress of at least about 50 dynes per square centimeter (dynes/cm2). The present invention also relates to methods of making and using the biomedical implant. The present invention further relates to a biomedical implant system.

Abstract: Adult autologous stem cells cultured on a porous, three-dimensional tissue scaffold-implant for bone regeneration by the use of a hyaluronan and/or dexamethasone to accelerate bone healing alone or in combination with recombinant growth factors or transfected osteogenic genes. The scaffold-implant may be machined into a custom-shaped three-dimensional cell culture system for support of cell growth, reservoir for peptides, recombinant growth factors, cytokines and antineoplastic drugs in the presence of a hyaluronan and/or dexamethasone alone or in combination with growth factors or transfected osteogenic genes, to be assembled ex vivo in a tissue incubator for implantation into bone tissue.

Abstract: The present invention provides high throughput assays for identifying compounds that modulate a contractile function, as well as devices suitable for these assays.

Abstract: A process for producing a cultured multi-layered skin cell sheet is provided.

Abstract: A method for expanding human corneal endothelial cells includes: (a) providing an amniotic membrane with or without amniotic cells, wherein the amniotic membrane has an extracellular matrix; (b) placing onto the amniotic membrane, a sheet of endothelial layer, or a cell suspension including human corneal endothelial stem cells; and (c) culturing the corneal endothelial cells on the amniotic membrane for a duration sufficient for the corneal endothelial stem cells to expand to an appropriate area. The invention also relates to a method for creating a surgical graft for a recipient site of a patient using the method for expanding human corneal endothelial cells, and the surgical graft prepared therefrom.

Abstract: A cell culture substrate is used comprising a photopolymerization initiator immobilized on a surface of the cell culture substrate, and a linear polymer immobilized on a part or the entirety of the surface via the photopolymerization initiator, and wherein the photopolymerization initiator is thioxanthone. Thereby, advantageously, a single type or multiple types of cells are efficiently cultured on specific regions of the culture substrate, and efficiently detached only by changing temperature on the surface of the substrate.

Abstract: The invention relates to a novel microcarrier bead; a method for producing same; a therapeutic comprising said microcarrier bead and attached thereto or grown thereon at least one selected cell or tissue type; a method for making said therapeutic; and a method of treatment involving the use of said microcarrier bead or said therapeutic.

Abstract: The subject innovation is directed to hierarchical structures characterized by ultrahigh surface area and methods of fabricating the same, as well as attachment of functional species to these structures to alter interactions of these hierarchical structures with their environments, such as by making them permanently or reversibly hydrophilic. One such example hierarchical structure can include a solid substrate, an intermediate layer, at least one plurality of nanoscale attachments that are strongly bonded to the intermediate layer, and an oxygen containing species coating the at least one plurality of nanoscale attachments.

Abstract: The present invention provides tissue scaffolds, methods of generating such scaffolds, and methods of use of such scaffolds to generate aligned and functional tissues for use in methods including regenerative medicine, wound repair, and transplantation.

Abstract: A method of making a three-dimensional biocompatible scaffold capable of supporting cell activities such as growth and differentiation, the method includes providing a supporting grid that forms an open network and provides mechanical support of a second biocompatible material. The second biocompatible material has interconnected cavities that allow nutrients, metabolites and soluble factors to diffuse throughout the scaffold. The scaffold design can be understood as a hierarchically organised structure. At the micron to submicron length scale a top/down manufacturing approach is used to make a structure that will constitute the frame into which a bottom/up processing approach is applied to form an open porous scaffold with specific nano sized features. The advantage of this hierarcially organised design is that benefits can be drawn independently from both the micron and the nano sized structures, promoting specific cell activities and providing sufficient mechanical compliance.

Abstract: The present invention provides a culture substrate which enables maintenance culture of human pluripotent stem cells in a pluripotent state under a feeder-free culture environment, and a culture method of human pluripotent stem cells using the culture substrate. By seeding human pluripotent stem cells dissociated into single cells at a cell density of 4×104 to 10×104 cells/cm2 onto a culture substrate coated with human laminin ?5?1?1 E8 fragment or human laminin ?3?3?2 E8 fragment preferably at a concentration of 0.5 to 25 ?g/cm2, the human pluripotent stem cells can be rapidly expanded in a pluripotent state.

Abstract: The invention provides a method for transferring cells to carriers, including: (a) providing a hydrophobic cell culture container or a cell culture container coated with a hydrophobic material on a bottom thereof; (b) adding carriers which are more hydrophilic than the hydrophobic cell culture container or hydrophobic materials and a culture medium containing cells into the hydrophobic cell culture container or the cell culture container coated with the hydrophobic material on the bottom thereof; and (c) culturing the cells, wherein the cells attach to the carriers and grow.

Abstract: A biocompatible implantable bone anchor is provided that has a threaded first portion that engages and anchors into a bone. The implant also has a neck region extending from the first portion adapted to promote autologous cell growth thereon at an interface of the bone and one or more epidermal or gum layers, the neck region having a plurality of channels extending about the neck region. The neck region is configured to mechanically engage at least one of an abutment, dental restoration, or osseous device attachment. An in situ bone anchor cell growth assembly includes the bone anchor and a manifold encompassing the neck portion so as to form a seal therebetween and a route of fluid communication between a manifold inlet and at least one of said plurality of channels. A process for growing autologous cells on a neck region of a bone anchor is provided.

Abstract: We disclose a particle comprising a matrix coated thereon and having a positive charge, the particle being of a size to allow aggregation of primate or human stem cells attached thereto. The particle may comprise a substantially elongate, cylindrical or rod shaped particle having a longest dimension of between 50 ?m and 400 ?m, such as about 200 ?m. It may have a cross sectional dimension of between 20 ?m and 30 ?m. The particle may comprise a substantially compact or spherical shaped particle having a size of between about 20 ?m and about 120 ?m, for example about 65 ?m. We also disclose a method of propagating primate or human stem cells, the method comprising: providing first and second primate or human stem cells attached to first and second respective particles, allowing the first primate or human stem cell to contact the second primate or human stem cell to form an aggregate of cells and culturing the aggregate to propagate the primate or human stem cells for at least one passage.

Abstract: The present invention provides a method for preparing mesenchymal stem cell-like cells and cardiomyocyte-like cells from induced pluripotent stem cells. With the method, embryoid bodies are first formed from induced pluripotent stem cells in a non-adherent substrate. The embryoid bodies are then contacted with a serum-free and insulin-free medium comprising a p38-MAPK inhibitor to form aggregates of contracting embryoid bodies. The contracting embryoid body aggregate(s) are then induced to form mesenchymal stem-cell-like cells and aggregates of cardiomyocyte-like stem cells with a medium comprising ?5% serum in a cell-culture treated substrate. The cardiomyocyte-like cells and the mesenchymal stem-cell like cells may be separated to give isolated populations of each cell type. The population of cardiomyocyte-like cells and mesenchymal stem-cell like cells and the isolated population of each cell type may be used for replacing cells.

Abstract: A method of patterning a surface of a substrate comprising: (a) applying a coating to the surface to form a coated surface, and (b) treating the coated surface with a patterned microplasma comprising a plurality of localised microplasma discharges such that localised regions of the coated surface are selectively exposed to the localised microplasma discharges to form exposed localised regions and unexposed regions that have not been substantially exposed to a microplasma discharge; wherein the coating at the exposed localised regions is modified by the patterned microplasma and the coating at the unexposed regions is substantially unmodified to form a patterned surface on the substrate.

Abstract: A cell culture comprising human foreskin cells, the human foreskin cells being capable of maintaining stem cells in an undifferentiated state when co-cultured therewith.

Abstract: Methods are generally disclosed for attaching a cell binding motif to a carboxy end of a coat protein of a Tobacco Mosaic Virus particle to form a modified-TMV particle; and attaching a cell to the cell binding motif of the modified-TMV particle.

Abstract: Adult autologous stem cells cultured on a porous, three-dimensional tissue scaffold-implant for bone regeneration by the use of a hyaluronan and/or dexamethasone to accelerate bone healing alone or in combination with recombinant growth factors or transfected osteogenic genes. The scaffold-implant may be machined into a custom-shaped three-dimensional cell culture system for support of cell growth, reservoir for peptides, recombinant growth factors, cytokines and antineoplastic drugs in the presence of a hyaluronan and/or dexamethasone alone or in combination with growth factors or transfected osteogenic genes, to be assembled ex vivo in a tissue incubator for implantation into bone tissue.

Abstract: The present invention provides a tissue construct-forming substrate for forming a three-dimensional tissue construct containing proliferating cells, the substrate including a porous film having through-holes, and the porous film having, on the surface of the film, a cell adhesive region capable of retaining cells and a cell non-adhesive region located at a peripheral region of the cell adhesive region, a tissue construct-forming kit comprising the above-mentioned tissue construct-forming substrate and a frame, and a method for forming the above-mentioned tissue construct.

Abstract: The invention concerns methods for automated culture of embryonic stem cells (ESCs) such as human ESCs. In some aspects, methods of the invention employ optimized culture media and limited proteolytic treatment of cells to separate cell clusters for expansion. Automated systems for passage and expansion of ESCs are also provided.

Abstract: A method for preparing a biological material for implanting provides irradiating at least a portion of the surface of the material with an accelerated Neutral Beam.

Abstract: Methods and reagents are described for myocardial regenerative therapy using cardiomyocytes that are cultured ex vivo to have a controlled orientation of beating. This is achieved by growing the cardiomyocytes on a culture support that is coated with a polymerizable liquid crystal which is oriented so as to be in a liquid crystal phase state prior to curing with ionizing radiation or ultraviolet rays.

Abstract: The present disclosure relates to an Extra Cellular Matrix composition specific for cancer type and a tumor microenvironment platform for long term culturing of tumor tissue, wherein said culturing provides human ligands and tumor tissue micro-environment to mimic physiologically relevant signalling systems. The present disclosure further relates to the development of a Clinical Response Predictor and its application in the prognostic field (selection of treatment option for the patient) and translational biology field (development of anticancer drugs). The disclosure further relates to a method of predicting clinical response of a tumor patient to drug(s). The disclosure further relates to a method for screening tumor cells for the presence of specific markers for determining the viability of said cells for indication of tumor status.

Abstract: Provided are a method capable of evaluating adherent cells under an environment similar to an in vivo environment by a culture method similar to a two-dimensional culture, and applications thereof. An adherent cell culture method uses, as a culture chamber (10), a chamber in which two or more culture spaces each having an equivalent diameter (D) that is 1 to 5 times the diameter of a desired spheroid and each having a height (H) that is 0.3 to 5 times the equivalent diameter are arranged and a surface of each of the culture spaces has a water contact angle of 45 degrees or less. Spheroids of adherent cells are cultured in the respective culture spaces (11) arranged in the culture chamber (10).

Abstract: In an embodiment of the disclosure, a biomedical material is provided. The biomedical material includes a biocompatible material having a surface and a carrier distributed over the surface of the biocompatible material, wherein both of the biocompatible material and the carrier have no charges, one of them has charges or both of them have charges with different electricity. The biomedical material is utilized for dentistry, orthopedics, wound healing or medical beauty and applied in the repair and regeneration of various soft and hard tissues.