Abstract: A table parlour game particularly a turbo-bowling comprising a turbo player unit (1), bowling pins (2) and a lane plate tilting to any direction (3). The turbo player unit (1) is a whirling top, namely a conical solid of rotation, the plate (1/a) of which is shaped to have a regular hexagonal pattern and furthermore equipped with a rotating tail (1/b) and tip (1/c) and the lane plate (3) is equipped by setting device (4) comprising centrally attached globe head (4/a) and globe shell (4/b).
Abstract: The invention provides an anti-unplugging unit attached to a plug of a transmission cord and to be put in a jack of electronic or communications equipment with the plug for preventing unauthorized removal of the plug from the jack. The anti-unplugging unit includes a latch member having an engaging portion for engaging a predetermined portion of a jack when the unit with the plug is inserted into the jack, lock means for selectively allowing or preventing release of engagement of the engaging portion with the predetermined portion of the jack, and a housing fixable to the plug and accommodating the latch member and the lock means. The invention also provides a transmission cord including a first cord having plugs at both ends, and the anti-unplugging unit fixed to at least one of the plugs.
Abstract: A composite solid strong acid comprising, a solid acid and a carbon material, wherein said solid acid is obtained by heat treating of polycyclic aromatic hydrocarbons or polycyclic aromatic hydrocarbons to which the carbon material is blended in concentrated sulfuric acid or fuming sulfuric acid, transforming said polycyclic aromatic hydrocarbons to a solid acid which is insoluble in a polar solvent by condensation and sulfonation further compositing with said carbon material.
Abstract: A method for preparation for mesoporous oxide comprising a non silica oxide having a hexagonal pore structure periodicity and an average maximum pore length of from 2 nm to 5 nm, characterized by comprising blending 0.003 mol to 0.01 mol of TaCl5, NbCl5 or a mixture thereof and Al isopropoxide comprising 10 g of an aliphatic linear alcohol and 1 g of a template compound to prepare a mixture for forming a sol solution, adding 5 mol to 35 mol (based on the metal compounds) of water or an aqueous inorganic acid solution to the mixture followed by hydrolysis and polycondensation to give a sol solution, transferring the sol into an oxygen containing atmosphere followed by again at 40° C. to 100° C. to form a gel, and then calcinating the gel in an oxygen containing atmosphere at 350° C. to 550° C.; and the mesoporous oxide obtained by the method.
Abstract: Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
Abstract: The present invention relates to a dental water heater. The water heater has a columnar body, and the body includes heating means extending in the axial direction of the body, and a plurality of layers of water channel sections arranged around the heating means. Each of the water channel sections spirally extends in the axial direction of the body. The adjacent pairs of the water channel sections are communicated either at upper or lower end portions thereof so as to together form a whole water channel. The whole water channel has an inlet and an outlet for water to be heated, so that water is supplied through the inlet, passed through the entire length of the whole water channel, and taken out as warmed water through the outlet.
Abstract: A method for the preparation of a dispersion of fine particles characterized in that the micelles are ones which have been formed in a aqueous medium with an amphiphilic block copolymer represented by the general formula PB and in which the shell of each micelle has been cross-linked with hydrophilic groups of the hydrophilic side chains wherein the particles formed are metallic particles having a reducing characteristic of metal ions.
Abstract: An intermediate for vinblastine synthesis represented by general formula A. general formula A. (in the formula, R1, R2, R3 and R4 are the group selected independently from the group consisting of H, lower alkyl group, lower alkoxy group, halogen, lower perfluoroalkyl group, lower alkylthio group, hydroxy group, amino group, mono- or di-alkyl or acylamino group, lower alkyl or arylsulfonyloxy group. R5 is H, or a lower alkyl group or a substituted or non-substituted aryl group, R6 is an alkyl group of carbon number 4 or less, R7 is a substituted or non-substituted aryl group, R8 is a substituted or non-substituted aryl group or lower alkyl group and R9 is an acyl group or trialkylsilyl group.
Abstract: The present invention is the method for preparation of transition metal oxide having micro-mesoporous structure whose average fine pores size is not less than 1 nm and not more than 2 nm comprising, adding and dissolving transition metal salt which is a precursor of transition metal oxide and/or metal alkoxide in the solution prepared by dissolving polymer surfactant in organic solvent, hydrolyzing said transition metal salt and/or metal alkoxide and preparing sol solution which is polymerized and self organized, then obtaining gel whose organization is stabilized from said sol solution and removing said polymer surfactant by using water of room temperature or water to which alkali metal or alkaline earth metal ion is added.
Type:
Grant
Filed:
October 2, 2002
Date of Patent:
May 29, 2007
Assignee:
Japan Science and Technology Agency
Inventors:
Kazunari Domen, Junko Nomura, Byonjin Ri
Abstract: Provided are a production process for a polymeric micelle which is stable and has a high drug content and a composition containing such polymeric micelle. Disclosed are a production process for a polymeric micelle, comprising the steps of dissolving a drug and a specific copolymer in a water non-miscible organic solvent to prepare a solution, mixing the resulting solution with water to form an O/W type emulsion and then slowly volatilizing the organic solvent from the solution, and a polymeric micelle composition charged therein with a water-scarcely soluble drug, which can be obtained by the above production process.
Abstract: The present invention provides a vinegar marine algae powder or grain which is rich in marine algae minerals and dietary fibers in a highly absorbable form and which has a favorable taste.
Type:
Grant
Filed:
September 11, 2001
Date of Patent:
May 8, 2007
Assignee:
Japan Pharmaceutical Development Co., Ltd.
Abstract: Provided is a flow-and-leveling agent for waterborne coatings which provides the coated surface with a flow-and-leveling property by blending into waterborne coatings taking a serious view of finishing and which improves coating defects such as ruptures and craters to contribute to a rise in the appearance of the coating film. The above flow-and-leveling agent is an acryl base copolymer containing a trimethylsilyl group in a proportion of 2 to 64% by weight and has a number average molecular weight of 500 to 30000.
Abstract: Conjugated peptides include a first peptide component which is an antigen associated with autoimmune disease, allergy, asthma or transplantation rejection and binds to an antigen-specific receptor on a T cell, and a second peptide component which corresponds to an “antigen presenting molecule”, namely, a peptide binding to a T cell surface receptor, which would normally promote T cell activation when the first peptide is bound to its antigen-specific T cell receptor. However, in this invention, the second peptide component has an amino acid sequence which is a modification of an antigen presenting T cell binding peptide, such modification blocking or inhibiting the engagement of receptor sites on the T cell surface (other than the antigen-specific T cell receptor). As a result, T cell activation is prevented, and is directed through antigen-specific T cell receptor occupation, without T cell activation, leading to antigen-specific T cell anergy and cell death.
Abstract: The object of the present invention are new desloratadine salts of formula I wherein the meaning of X is an acid residue and the meaning of n is 1 or 2, and formula II wherein the meaning of X is a pK <3.5 acid residue.
Type:
Grant
Filed:
November 14, 2001
Date of Patent:
March 27, 2007
Assignee:
Richter Gedeon Vegyészeti Gyár RT.
Inventors:
János Fischer, Tamás Fodor, Ferenc Trischler, Jr., legal representative, Tamás Róbert Trischler, legal representative, Gabriel Maria Trischler, legal representative, Sándor Lévai, Endréne Petényi, Ferenc Trischler, deceased