Abstract: Provided are magnesium hydroxide particles having a hexagonal crystal form and having an aspect ratio (H) which satisfies the following expression (I), 0.45·A·B<H<1.1·A·B??(I) (wherein H is an aspect ratio, A is an average secondary particle diameter (?m) of all of the particles measured by a laser diffraction scattering method and B is a specific surface area (m2/g) of all of the particles measured by a BET method), a flame-retardant comprising the particles, a flame-retardant resin composition comprising 100 parts by weight of a synthetic resin and a 5 to 300 parts by weight of the magnesium hydroxide particles, and a molded article therefrom. The magnesium hydroxide particles are hexagonal single crystals, the hexagonal form thereof are not necessarily required to be regular hexagonal, and the size thereof are not necessarily constant.

Abstract: Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.

Abstract: The present invention relates to a sheet or board like multiple layers laminated polyolefin foam having a plurality of polyolefin layers laminated on at least one side of a polyolefin foam by a coextrusion method. More specifically, the present invention relates to said multiple layers laminated polyolefin foam, wherein the thickness of the outermost layer constituting the plurality of polyolefin layers is 5 to 80 ?m, and the density d (g/L) of the polyolefin foam, the melt flow rate X (g/10 min) of the polyolefin constituting the innermost layer among the plurality of polyolefin layers, and the thickness Y (?m) of the innermost layer of the multiple polyolefin layers satisfy the following relationships (1) to (4). Y?0.

Abstract: A dye fixing agent for water-color ink to be contained in the water-color ink accepting layer of an ink jet recording medium having an water-color ink accepting layer formed on a substrate, which is a hydrotalcite compound containing a silicic acid anion and a sulfuric acid ion, or a silicic acid anion as an anion(s). An ink jet recording medium comprising the dye fixing agent for water-color ink formed on a substrate. The dye fixing agent for water-color ink of the present invention is excellent in the fixability of water-color ink, the resolution of an image recorded on a medium, water resistance and light resistance.

Abstract: The present invention is based, in part, on the discovery that a modified version of Peptide G (Asn Gly Gln Glu Glu Lys Ala Gly Val Val Ser Thr Gly Leu Ile—SEQ ID NO:2) obtained by replacing Asn with Asp to form Peptide G? (Asp Gly Gln Glu Glu Lys Ala Gly Val Val Ser Thr Gly Leu Ile—SEQ ID NO: 1) overcomes the long range stabilization problem of the peptide conjugates and, quite surprisingly, also enhances the immune response, particularly the CD4 related (cell mediated) response, of conjugated peptides (L.E.A.P.S. constructs) as previously described.

Abstract: A solution for washing away residue, comprising an aqueous solution of a water-soluble high molecular compound in which is dissolved at least one kind of dissolving agent selected from an amine and a fluoride. The washing solution is capable of effectively washing away the residue formed during the production of electronic circuits, is very lowly corrosive to the insulating films, low-dielectric interlayer insulating films and wirings, and offers an advantage of little generating foam.

Abstract: The present invention provides compositions blended in hair treating agents which can prepare a hair conditioner, a coloring agent, a waving agent, a finishing agent, a feeling improving agent, a perfume dispersing agent, a refreshner or a thickning agent easily and by lower price, further provides a hair treating agent which is excellent in hair treating feature, such as moist feel, slippery feel, wetting feeling, smooth feel, soft feel, slightly oily feel, rustle feeling, luster, supple, no stickiness, smooth combing, setting ability by containing alcohols.

Abstract: The present invention features phosphorus containing epoxy resin compositions useful for imparting flame retardant properties to prepregs, resin-clad metal foils, and laminate boards constructed therefrom. The phosphorus containing epoxy resin composition (a) comprises a phosphorus containing epoxy resin (A) and a hardener. The phosphorus containing epoxy resin (A) has an epoxy equivalent of 300-500 g/eq. and comprises the reaction product of a phosphorus containing organic compound (B) and at least one epoxy resin (C). Phosphorus containing compound (B) is the reaction product of organic phosphorus compounds (b) having one active hydrogen atom bonded to a phosphorus atom and a quinone compound, wherein the molar ratio of (b) to quinone is from 1.25:1 to 2:1. This molar excess of (b) yields a phosphorus containing compound (B) that comprises both the reaction product of (b) and quinone, as well as un-reacted (b).

Abstract: A dental polymerizable and curable composition that can be used as a dental composite restorative featuring excellent handling property at the time of filling, a small contraction upon polymerization, a high bending strength, excellent surface smoothness and wear resistance, and a very good matching of color tone to the natural tooth after restored.

Abstract: Disclosed is a method of producing a powdery coating material by using a curable acrylic resin (A) having a number average molecular weight of from 2,000 to 20,000 and a glass transition temperature of from 30 to 90° C. obtained by polymerizing a starting monomer containing from 15 to 50 mol % of an unsaturated compound which contains at least a glycidyl group and/or a methylglycidyl group, and from 20 to 50 mol % of methyl methacrylate; a curing agent (B) capable of being reacted with the glycidyl group or the methylglycidyl group constituting the curable acrylic resin (A); and an alcohol solvent (C) having a boiling point under normal pressure of from 70 to 120° C.; said method comprising a kneading step of so kneading the curable acrylic resin (A), the curing agent (B) and the alcohol solvent (C) that at least the curing agent (B) is dissolved in the alcohol solvent (C) at a temperature of not higher than 130°C.

Abstract: A photocationic polymerization initiator comprising (A) a photo acid-generating compound and (B) a fused polycyclic aromatic compound, wherein said fused polycyclic aromatic compound has a molecular structure in which a fused aromatic ring is further condensed with a non-aromatic ring, and at least one of the atoms constituting said non-aromatic ring directly bonded to a common atom in the fused aromatic ring and the non-aromatic ring, is a saturated carbon atom, said saturated carbon atom having at least one hydrogen atom. Upon blending the photopolymerizable monomer with the photocationic polymerization initiator, there is obtained a photocationically polymerizable composition having a high sensitivity for the visible light rays, which is useful for dental applications, exhibiting a sufficiently high curing rate and offering sufficient depth of curing upon the irradiation with light for only a short period of time.

Abstract: A polymer compound which is a polyphenylene co-condensation polymer consisting substantially of paraphenylene group and metaphenylene group and improved in forming ability and functions, wherein the ratio of metaphenylene group is in the range of 60 to 95%.

Abstract: This invention provides a method of reactivating a catalyst for methacrylic acid production, which catalyst is used in production of methacrylic acid through vapor-phase oxidation of methacrolein or vapor-phase oxidative dehydrogenation of isobutyric acid, contains P and Mo, and exhibits reduced activity. The process comprises treating the catalyst, whose activity level has dropped (deteriorated catalyst), with a gas containing a nitrogen-containing heterocyclic compound (e.g., pyridine, piperidine, piperazine, quinoline).

Abstract: A method of preparing a ceramic artificial crown by applying at least one kind of dental porcelain onto the surface of a ceramic core molded by heating and softening a ceramic material and putting it into a mold with the application of pressure followed by firing wherein said mold is the one formed by burning a wax pattern after having removed a crucible former from an assembly which makes it possible to efficiently prepare a fully ceramic artificial crown of a high quality in a short period of time.

Abstract: An antifouling coating composition comprising (A) a silyl ester copolymer containing constituent units derived from a polymerizable unsaturated carboxylic acid silyl ester; (B) a carboxylic acid; (C) a bivalent or trivalent metal compound; and (D) a dehydrating agent. It is preferred that the component (C) be contained in an amount of 1.2 equivalents or more, in terms of the number of equivalents of metal as a constituent of the component (C), per equivalent of carboxyl group of the carboxylic acid (B); that the component (C) be a bivalent metal compound; and that the component (C) be a compound of at least one metal selected from the group consisting of zinc, copper, magnesium, calcium and barium.

Abstract: A ball for ball games, organized in 18 squares and adjusted by 8 helices, wherein the ideal sphericity is obtained when the distance from the center (Y) to the corners of the triangle in the center of the helix is equal to the difference in distance that exists between the square and its diagonal: If c=sqrt(3)*(d?a) and d=?C, then sphere.

Abstract: An isoquinuclidine derivative represented by the following general formula (I): (I) [wherein A1 is methylene or carbonyl]: R1 is hydrogen or methyl: R2 is —(CH2)n-A2-Ph (n is an integer of 0 to 3 and A2 is a single bond or —O—): and R3 is —COOH, —COOR4, —COSR4 (R4 is lower alkyl, unsubstituted phenyl, or phenyl substituted by a lower alkyl, lower alkoxy, hydroxyl, methoxycarbonyl, ethoxycarbonyl, or trifluoromethanesulfonamide group or by a halogen atom), etc.] or a pharmaceutically acceptable salt of the compound. Also provided is an oral remedy for diabetes, which contains the compound and has hypoglycemic activity.

Abstract: A process for producing thermo-expansive microcapsules wherein a polymerizing mixture containing ethylenic unsaturated monomer and a blowing agent is suspend-polymerized to microencapsulate the blowing agent with the resultant polymer. The above-mentioned suspension-polymerization is performed with the presence of at least one compound selected from the group consisting of polypeptides and derivatives thereof as a suspension stabilizer. The process can control the particle size of microcapsules easily, attain stable reaction system and produce thermo-expansive microcapsules that disperse well in medium such as paint or inks.

Abstract: This invention relates to a breakthrough method for pre-sensitizing cancer prior to a therapeutic treatment such as chemotherapy, radiation therapy or immuno-therapy and a novel cytokine mixture used in the method thereof. The cytokine mixture is a serum-free and mitogen-free mixture comprised of specific ratios of cytokines such as IL-1?, TNF-?, IFN-? and GM-CSF to Interleukin 2 (IL-2), which is effective in inducing cancerous cells to enter a proliferative cell cycle phase thereby increasing their vulnerability to chemotherapy, radiation therapy and immuno-therapy. One such novel cytokine mixture is Multikine®, which can be used alone or in combination with other drugs for the treatment of cancer thereby increasing the success of cancer treatment and the disease free survival of cancer patients.

Abstract: An ethylene copolymer composition comprising an ethylene/?-olefin copolymer, A-4, of ethylene with an ?-olefin of 3 to 20 carbon atoms in an amount of 65-98% by weight, whose melt tension, MT, at 190° C. and MFR satisfy the relation MT>2.2×MFR?0.84, and at least one crystalline polyolefin, B-2, in an amount of 1-40% by weight selected from the group consisting of, B-I, an ethylene homopolymer or a copolymer of ethylene with an ?-olefin of 3 to 20 carbon atoms, prepared using a non-metallocene type catalyst, B-II, a propylene hompolymer or a copolymer of propylene with at least one olefin selected from ethylene and an ?-olefin of 4 to 20 carbon atoms, and, B-III, a homopolymer of an ?-olefin of 4 to 20 carbon atoms or a copolymer of ?-olefins of 4 to 20 carbon atoms, and articles made from the composition.