Abstract: A vaccine or immunogenic composition comprising at least two fragments of proprotein convertase subtilisin/kexin type 9 (PCSK9) where one fragment contains at least 9 consecutive residues of residues 153 to 165 of PCSK9 and the other fragment contains at least 9 consecutive residues 209 to 222 of the PCSK9 (SEQ ID NO:9). Methods of treatment for hyperlipidemia, hypercholesterolemia, and atherosclerosis involving administering this vaccine.

Abstract: A method for preventing and/or treating a synucleinopathy, comprising administering a composition containing at least one mimotope of an epitope of alpha-synuclein, wherein said at least one mimotope is coupled or fused to a pharmaceutically acceptable carrier protein selected from the group consisting of a non-toxic diphtheria toxin mutant, keyhole limpet hemocyanin (KLH), diphtheria toxin (DT), tetanus toxid (TT) and Haemophilus influenzae protein D (protein D).

Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.

Abstract: The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.

Abstract: The present invention relates to a vaccine comprising at least one peptide consisting of 7 to 19 amino acid residues consisting of the amino acid sequence (X3)mKDX2QLGX1 (SEQ ID No. 99), wherein X1 is an amino acid residue selected from the group consisting of alanine, asparagine, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, serine, threonine, tyrosine and valine, X2 is an amino acid residue selected from the group consisting of alanine, arginine, histidine, isoleucine, leucine, lysine, methionine, threonine, tyrosine and valine. X3 is (X4)nANISX5 (SEQ ID No. 100) or an N-terminal truncated fragment thereof consisting of 1 to 4 amino acid residues, X4 is VVASQLR (SEQ ID No.

Abstract: Vaccine comprising a peptide bound to a pharmaceutically acceptable carrier, said peptide having the amino acid sequence (Formula?I) (SEQ?ID?NO:?1) (X1)m(X2)n(X3)oX4X5HPX6, for treating and/or preventing a physical disorder associated with the renin-activated angiotensin system, wherein X1 is G or D, X2 is A, P, M, G, or R, X3 is G, A, H, or V, X4 is S, A, D, or Y, X5 is A, D, H, S, N, or I, X6 is A, L or F, wherein m, n and o are independently 0 or 1 under the premise that when o is 0 m and n are 0 and when n is 0 m is 0, and wherein the peptide is not DRVYIHPF (SEQ ID NO:4).

Abstract: The present invention relates to a composition comprising at least one mimotope of an epitope of alpha-synuclein for use in a method for preventing and/or treating synucleinopathies, wherein said at least one mimotope is coupled or fused to a pharmaceutically acceptable carrier protein selected from the group consisting of a non-toxic diphtheria toxin mutant, keyhole limpet hemocyanin (KLH), diphtheria toxin (DT), tetanus toxid (TT) and Haemophilus influenzae protein D (protein D).

Abstract: The present invention relates to a composition comprising at least one mimotope of an epitope of alpha-synuclein for use in a method for preventing and/or treating ?-amyloidoses including Alzheimer's disease, wherein said at least one mimotope is coupled or fused to a pharmaceutically acceptable carrier protein selected from the group consisting of a non-toxic diphtheria toxin mutant, keyhole limpet hemocyanin (KLH), diphtheria toxin (DT), tetanus toxid (TT) and Haemophilus influenzae protein D (protein D).

Abstract: The present invention relates to a vaccine comprising at least two fragments of Proprotein convertase subtilisin/kexin type 9 (PCSK9), wherein said at least two fragments comprise at least 8 consecutive amino acid residues of amino acid residues 150 to 170 and/or 205 to 225 of PCSK9 (SEQ ID No. 9).

Abstract: Vaccine comprising a peptide bound to a pharmaceutically acceptable carrier, said peptide having the amino acid sequence (SEQ?ID?NO:?1) (X1)m?(X2)n?(X3)o?X4?X5?H?P?X6 (Formula?I), for treating and/or preventing a physical disorder associated with the renin-activated angiotensin system, wherein X1 is G or D, X2 is A, P, M, G, or R, X3 is G, A, H, or V, X4 is S, A, D, or Y, X5 is A, D, H, S, N, or I, X6 is A, L or F, wherein m, n and o are independently 0 or 1 under the premise that when o is 0 m and n are 0 and when n is 0 m is 0, and wherein the peptide is not DRVYIHPF (SEQ ID NO:4).

Abstract: The present invention relates to peptides or polypeptides for producing medicaments for preventing and/or treating synucleinopathies.

Abstract: Disclosed is a method for diagnosing Alzheimer's disease (AD) wherein A?-specific antibodies in a biological sample of a person that is suspected of having AD are detected comprising the following steps: —contacting the sample with A?-aggregates or with particles having A?-aggregate like surfaces and allowing the A?-specific antibodies to bind to the A?-aggregates, and —detecting the A?-specific antibodies bound to the A?-aggregates by a single particle detection technique, preferably by fluorescence activated cell sorting (FACS); and wherein the amount of A?-specific antibodies detected is compared with the amount in a sample of known AD status.

Abstract: Disclosed is a method for detecting A?-specific antibodies in a biological sample comprising the following steps:—contacting the sample with A?-aggregates or with particles comprising A?-aggregate like surfaces and allowing the A?-specific antibodies to bind to the A?-aggregates, and -detecting the A?-specific antibodies bound to the A?-aggregates by a single particle detection technique, preferably by fluorescence activated cell sorting FACS.

Abstract: The present invention relates to the use of compounds for producing a medicament for preventing and/or treating atherosclerosis, atherosclerosis risk diseases and atherosclerosis sequelae.

Abstract: The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.

Abstract: The present invention relates to a method for treating atherosclerosis and/or atherosclerosis sequelae with a compound that includes FX8(F)oPX9HX10X11X12DX2X3X4X5X6X7 where X8 is G, A, F, Y or K, X9 is E, Y, A, Q, K or S, X10 is H, V, L, F or I, X11 is L, W, S, I, F or Y, X12 is V, T, F or I, X5 is S or Y, X6 is L, A or I, X7 is S, N or T, and o is 0 or 1.

Abstract: The present invention relates to the use of mimotopes in the treatment of diseases associated with ?-amyloid formation and/or aggregation (?-Amyloidoses) including Alzheimer's disease, whereby said mimotopes are able to induce the in vivo formation of antibodies directed to A?1-40/42, A?pE3-40/42, A?3-40/42 and A?11-40/42.

Abstract: The present invention relates to a vaccine comprising at least one peptide consisting of amino acid sequence LRAN-ISHKDMQLGR (SEQ ID No. 1) or a peptide fragment thereof (SEQ ID No. 2-13) coupled or fused to a carrier protein comprising at least one T cell epitope, wherein said peptide fragment comprises at least 7 amino acid residues and the amino acid sequence KDMQLGR (SEQ ID No: 7) or KDMQLG (SEQ ID No: 23) under the provision that the peptide fragment does not consist of amino acid sequences HKDMQLGR (SEQ ID No: 16) and HKDMQLG (SEQ ID No: 22).

Abstract: The present invention relates to the use of mimotopes in the treatment of ?-Amyloidoses including but not limited to Alzheimer's disease, whereby said mimotopes are able to induce the in vivo formation of antibodies directed to non truncated A?1-40/42, and N-terminally truncated forms A?pE3-40/42, A?3-40/42, A?11-40/42, A?pE11-40/42 and A?14-40/42 without interfering with physiological functions of APP signalling.

Abstract: Vaccine comprising a peptide bound to a pharmaceutically acceptable carrier, said peptide having the amino acid sequence (Formula?I) (SEQ?ID?NO:?1) (X1)m(X2)n(X3)oX4X5HPX6, for treating and/or preventing a physical disorder associated with the renin-activated angiotensin system, wherein X1 is G or D, X2 is A, P, M, G, or R, X3 is G, A, H, or V, X4 is S, A, D, or Y, X5 is A, D, H, S, N, or I, X6 is A, L or F, wherein m, n and o are independently 0 or 1 under the premise that when o is 0 m and n are 0 and when n is 0 m is 0, and wherein the peptide is not DRVYIHPF (SEQ ID NO:4).