Abstract: The present invention concerns compounds of formula (I), enantiomers, mixture of enantiomers, diastereoisomers and mixture of diasteroisomers thereof formula (I): wherein at least one of W, X and Y is selected from the group consisting of —NR1R2; —NR3—(CH2)n—NR4R5; —O—(CH2)n—NR4R5; —NR3—(CH2)n—N?R6R7R8; and —O—(CH2)n—N?R6R7R8 and Z is a functional group capable of chelating iron salts. The present invention also concerns the compounds of formula (I) for use as a drug, in particular, in the treatment of cancer and malaria.

Abstract: The invention relates to a process for selectively and continuously extracting a series of desired species from a matrix, comprising the steps of:—injecting a plasma (310) in an extraction chamber by means of a plasma torch,—continuously monitoring (320) the excited elements extracted from the matrix and contained in the plasma by optical emission spectroscopy, and for each species of the series,—setting a distance (330) between the support and the plasma torch, and the composition of the injected plasma as a function of the monitored excited elements so that only one desired species of the series of species is being extracted from the matrix under molecular form, and—providing (400) a plate in the extraction chamber, exterior to the plasma, causing collection of molecules comprising said desired species by deposition onto the surface of the plate.

Abstract: The invention relates to a silicone composition comprising (a) crosslinked polymers comprising consecutive —Si—O— units containing exchangeable pendant bonds and exchangeable crosslinking points, that are exchangeable by aldehyde-imine exchange reactions and/or by imine-imine exchange reactions and/or by imine-primary amine exchange reactions, obtained by crosslinking linear or branched polymers comprising consecutive —Si—O— units and (b) monofunctional free aldehydes and/or monofunctional free imines and/or monofunctional free primary amines.

Abstract: The present invention relates to compounds of the following general formula (I) or (II) or a pharmaceutically acceptable salt and/or solvate thereof, for use in the prevention and/or the treatment of disorders associated to gammaherpesvirinae, in particular to the human herpesvirus 8 (HHV8) or the human herpes virus 4 (HHV4), and pharmaceutical compositions containing such compounds.

Abstract: Process for treating a magnetic structure, wherein it comprises the following steps: providing a magnetic structure comprising one first layer of magnetic material comprising a CoFeB alloy; irradiating the magnetic structure with light low-energy ions; and simultaneously holding the magnetic structure with a preset temperature profile and for a preset time.

Abstract: A process for preparing a porous solid with an outer surface modified by at least one polymer; the polymer being simultaneously synthetized in solution and grafted on the outer surface of the solid, includes contacting: a porous solid; and a polymer-precursor solution comprising an adhesion primer, and at least one polymerizable monomer; under conditions enabling the formation of radical entities.

Abstract: The invention relates to an imaging device (E) comprising: at least one generator (1) of structured light; an emission first image guide (5, 5?) for uplinking the structured light from the generator (1) to an object to be observed; and a return second image guide (5?, 5) for downlinking the light reflected by said object to be observed to a system (2) for capturing said reflected light. Each of the two image guides (5, 5?) is able to uplink the structured light and downlink the reflected light, and the imaging device comprises an optical switch (3) configurable into three different operating modes.

Abstract: The present invention relates to antibodies or fragments thereof that specifically bind to glycoprotein (GP) of Ebola virus, and to their use for treating and diagnosing Ebola virus disease.

Abstract: A wheelchair having two drive wheels, each provided with a rotary drive motor wherein the value of the drive torque applied by each motor is controlled such as to stabilize the wheelchair, while in motion on the two drive wheels and occupied by a user, in an inclined balance position.

Abstract: The present invention relates to a novel use of total cellular iron, preferably under the form of ferrous iron (Fe2+), as a marker of cancer stem cells (CSCs). The invention also relates to methods using said iron marker, in particular for metastatic cancer diagnosis or treatment, for screening for compounds of interest, as well as for killing CSCs.

Abstract: A method for the inscription of second-order nonlinear optical properties on a support including an amorphous material, the method including: heating the support within a temperature range allowing the movement of charges inside the support; applying a structured electrode to the support, generating an electrical field designed to induce the formation of non-linear optical properties on the surface of the support; and cooling the support.

Abstract: Multimenic lectins having a ?-propeller architecture, formed from monomer modules of approximately 30 to 60 amino acids, in which the binding sites to the glycans are situated on a given side of the proteins and the O-terminus and N-terminus ends of the peptide chains on the other side of the proteins, characterized in that they are formed from 4 to 7 monomer modules, a single, or a plurality of, or all of the adjacent modules being linked to one another by the linkers linking the N-terminus end of one module to the C-terminus end of the adjacent module.

Abstract: PmxA synthetase involved in polymyxin E synthesis, comprising four adenylation sites, characterized in that the second adenylation site has at least 90% identity with the peptide sequence SEQ ID NO 1: VTEAEKADLLGRFNDTTTEFPRGKTLIQLFEEQVERIPDAAAITLNEQE LTYRELNERVNRLARTLRSHGISKGRLVAILAERSIEMVVGMLAAHKAG AAYVPIDPEYPEERIRFLIEDSGGQVMLTQSRLRERLAGSDPVILLDDE SFYHEDGTNLNTGIEATDLACVIYTSGTTGKPKGNPVSHRNIVRVVQNT NYIDITERDHVLQLSSYSFDGATFDIFGALTNGARLVLVPYETLLEIGR LADLIQRERISVMFITTAFFNILVDVNVDCLRDVRAILFGGERVSVGHV RKALAHIGPGRLNHVYGPTESTVYTTYLPVDFVDELAVTVPIGRPISNT TVYIVDSRNKLLPIGVAGELCVGGEGLVRGYNNRPELTAEKFVDNPFVP GERMYRTGDLAKWLPDGTIEYVGRTDDQVKIRGFRIELGEIEAQLQKVE GIRKTTVFARENASGEKQLCAYYEADCELPAAELKSVLSKELPAYMIPA YLIQLERLPLTTNGKVDRRSLPAPEESLQPGGG, the underlined amino acids DGFFLGVVYK being conserved and forming a binding pocket specific for a leucine, isoleucine or valine residue.

Abstract: Today, despite current advances in combinatorial therapies such as surgery, radiotherapy and chemotherapy, aggressive cancers remain fatal. Cancer stem-like cells (CSCs) may account for chemotherapy resistance and thus represent a promising therapeutic target. In this context, the present inventors identified essential intracellular pathways favoring the self-renewal and survival of CSCs. More precisely, the present inventors showed that the cytokine co-receptor GP130 acts as a co-receptor for Apelin/APJ signaling and that the interaction of Apelin with APJ/GP130 activates a dual signaling pathway involving the Akt/mTOR and STAT3 transcription factor, thereby promoting CSCs survival and self-renewal. They therefore propose to block these pathways in order to treat patients suffering from tumors containing CSCs, such as glioblastomas. In another aspect, the invention relates to the use of the Apelin expression level for evaluating the survival probability of a subject suffering from glioblastoma.

Abstract: The invention relates to a method for making a micro- or nano-scale patterned layer of material by photolitography, comprising steps of: positioning a photomask between a light source and a layer of light sensitive material, said mask comprising a support and a layer of micro- or nano-light focusing elements fixed to the support, activating the light source so that the light source emits light radiations through the mask towards a surface of the layer of light sensitive material, developing the layer of light sensitive material so as to obtain the micro- or nano-scale patterned layer of material, wherein, during exposure of the layer of light sensitive material to light radiations, the photomask is positioned relative to the light sensitive layer so that the distance between the surface of the light sensitive layer and the layer of micro- or nano-light focusing elements is greater than a back focal length of the micro- or nano-light focusing elements.

Abstract: The invention relates to a micro Organic Opto-electronic device comprising a dielectric substrate (61, 131) and superposed on the dielectric substrate (61, 131): a first planar electrode (62) with a first extremity (65c); an organic layer stack (67), at least partially covering the first extremity; a second planar electrode (63) covering partially said first extremity (65c) and said organic layer stack (67) with a part, defining an active area (64); wherein the position and the geometry of the first extremity (65c) is configured so that the first extremity (65c) delimits a hollow zone (66) without conductive material, with an arch (65) surrounding the hollow zone (66), the arch (65) having two arms (65a) and a branch (65b) connecting the two arms (65a), the active area (64) been limited by the transversal dimension (Wb) of the said branch (65b) and the transversal dimension (W) of the part of the other extremity (63a).

Abstract: The invention relates to a Micro Organic Opto-Electronic device emitting a light impulse having a time response below 10 ns, in response to an electrical impulse having a pulse duration time below 10 ns, comprising a dielectric substrate (61, 131) which supports: at least one ground plane (121a, 121b); a first planar electrode (62, 71, 171); an organic layer stack (67, 72, 135) partially covering said first planar electrode (A, 62); a second planar electrode (63, 73, 173) with at least a part covering said organic layer stack (135) and said first planar electrode (62, 71, 171); defining an active area (45, 54, 64, 74) of the Organic Opto-Electronic device; some electrical wires for the voltage supply connected to the first planar electrode (62, 71, 171) and to the second planar electrode (63, 73, 173); the first planar electrode (62, 71, 171), the second planar electrode (63, 73, 173) and the ground plane (121a, 121b) are separated by gaps (132, G, h) without conductive material, the gaps (132, G, h) havi

Abstract: A catalyst composition contains an inorganic porous material with pore diameters of at least 2 nm and of crystals of molecular sieve. The crystals of molecular sieve have an average diameter, measured by scanning electron microscopy, not bigger than 50 nm. The catalyst composition has a concentration of acid sites ranges from 50 to 1200 ?mol/g measured by TPD NH3 adsorption. An XRD pattern of the catalyst composition is the same as an XRD pattern of the inorganic porous material.

Abstract: The invention relates to a process for manufacturing at least one implant for focal electrical stimulation of a nervous structure, said implant being of the type including in a supporting structure a network of cavities at the bottom of which are placed microelectrodes, the cavities being bounded by walls erected and located around the microelectrodes, the supporting structure being produced beforehand by implementing the following steps: deposition and etching, in a planar manner, on an insulating substrate, of electrical contacts, of electrical tracks and of microelectrodes, first tracks electrically connecting the microelectrodes and the electrical contacts, second electrical tracks being electrically connected to a ground.

Abstract: In a method and magnetic resonance (MR) apparatus for MR image reconstruction, an image reconstruction algorithm is used that operates on one calibration matrix that is formed by reorganizing a number of individual, undersampled k-space data sets respectively acquired by multiple reception coils in a parallel MR data acquisition from a subject exhibiting motion. The motion causes the k-space data sets to exhibit errors. In order to use the calibration matrix in the reconstruction algorithm, it is subjected to an iterative rank reduction procedure in which, in each iteration, a residual is calculated for each data point that represents how poorly, due to motion-induced corruptions, that data point satisfies the low rank constraint, and non-satisfying data points are removed from the data point for the next iteration. The resulting low rank matrix at the end of the iterations is then used to produce images with fewer motion-induced errors.