Patents Assigned to Engineering
-
Publication number: 20160365577Abstract: A positive electrode comprising ?-VOPO4 and/or Nax(?-VOPO4) wherein x is a value from 0.1 to 1.0 as an active ingredient, wherein the electrode is capable of insertion and release of sodium ions and a reversible sodium battery containing the positive electrode are provided.Type: ApplicationFiled: June 10, 2015Publication date: December 15, 2016Applicants: Toyota Motor Engineering & Manufacturing North America, Inc., The Research Foundation for The State University of New YorkInventors: Ruigang ZHANG, Fuminori MIZUNO, Chen LING, M. Stanley WHITTINGHAM, Ruibo ZHANG, Zehua CHEN
-
Publication number: 20160366247Abstract: A method of updating a vehicle ECU includes establishing communication between a data communications module of a vehicle and an update server via a cellular network; validating the vehicle using a key exchange protocol between the data communications module and the update server; and sending update information from the update server to the data communications module of the vehicle via the cellular network, the update information configured to be used to update the vehicle ECU.Type: ApplicationFiled: August 25, 2016Publication date: December 15, 2016Applicant: Toyota Motor Engineering & Manufacturing North America, Inc.Inventor: Derek Lane Lewis
-
Publication number: 20160362165Abstract: Disclosed are a system and method for controlling fuel supply to an engine for ships. The system for controlling fuel supply to an engine for ships includes: a system operating zone in which LNG is pumped by a pump and gasified; and a supply operating zone receiving the pumped and gasified LNG from the system operating zone and supplying the LNG to the engine, wherein a preset pressure of the system operating zone is set to be higher than that of the supply operating zone.Type: ApplicationFiled: January 30, 2015Publication date: December 15, 2016Applicant: DAEWOO SHIPBUILDING & MARINE ENGINEERING CO., LTD.Inventor: Dong Chan KIM
-
Patent number: 9517850Abstract: A rotating tucking device for securing a wrapper to a roll in a roll packaging system comprises a tucking arm for insertion into a hollow cavity of a roll and a rotating insertion system connected to the tucking arm for moving the tucking arm in a rotational pattern coordinated with the movement of the roll through the roll packaging system such that the tucking arm and the rotating insertion system tuck a wrapper into the hollow cavity of the roll as the roll moves continuously through the roll packaging system. Also provided is a roll packaging system having a rotating tucking device, as well as a rotating tucking method for securing a wrapper to a roll as the roll moves continuously through the roll packaging system.Type: GrantFiled: July 17, 2013Date of Patent: December 13, 2016Assignee: Infinity Machine & Engineering Corp.Inventors: Christian Zagnoni, Todd Lee Hanson, Scott Santaga
-
Patent number: 9517620Abstract: A printing device is provided and includes: a head unit and a controller. The head unit performs a main scan operation corresponding to each of a predetermined N-number of printing passes (N is an integer of three or greater) on a same area of a medium in a multi-pass mode, and the controller sets a density of printing to be performed in a k-number of last printing passes (k is an integer which is equal to or greater than 1 and is less than N), so as to be lower than a density of printing to be performed in the (N?k)-th printing pass, and sets a density of printing to be performed by a plurality of individual nozzles of the nozzle row of the head unit for ejecting ink drops in the (N?k+1)-th printing pass, so as to gradually decrease toward a head rear end side.Type: GrantFiled: November 13, 2014Date of Patent: December 13, 2016Assignee: MIMAKI ENGINEERING CO., LTD.Inventors: Masakazu Okajima, Eiichi Ohara, Junki Kasahara
-
Patent number: 9518730Abstract: A large-size circulating fluidized bed boiler, comprising: a furnace having a vertical furnace center line; and at least two groups of cyclones, each cyclone of each group of cyclones having an inlet gas pass communicated with the furnace. A furnace cross section formed by outer sidewalls and located at the inlet gas pass of the cyclone is a polygon having 2×n sides, and n is a positive integer greater than 1. The polygon is axially symmetric with respect to a perpendicular bisector of each side of the polygon, and when n is 2, the polygon is a square. Triangles formed by two endpoints of an inlet of the inlet gas pass of each cyclone at the cross section and an intersection of the furnace center line and the cross section are congruent. A single flow field in communication with each of the inlet is formed in the cross section.Type: GrantFiled: January 19, 2012Date of Patent: December 13, 2016Assignee: Institute of Engineering Thermophysics, Chinese Academy of SciencesInventors: Qinggang Lu, Ming Gao, Yunkai Sun, Guoliang Song, Xiaofang Wang, Yongjie Na, Dongyu Wang, Haigang Wang
-
Patent number: 9520678Abstract: A signal transmission connector includes an insulating body, a plurality of first terminals, a plurality of second terminals, and a rear casing. The insulating body has a dielectric constant of about 3 to 3.4. The first and second terminals are disposed on the insulating body. The first and second terminals have widths of about 0.36 to 0.42 mm. The rear casing is assembled at the second end of the insulating body. The rear casing envelops the first and the second terminals. The rear casing has a dielectric constant of about 3.5 to 3.8. The connector provides adjustable impedance without modifications to the terminal structures and also reduces cost.Type: GrantFiled: November 23, 2015Date of Patent: December 13, 2016Assignee: NEXTRONICS ENGINEERING CORP.Inventors: Hou-An Su, Hung-Wei Hsu, Chang-Fa Yang, Huai-Sheng Wang
-
Patent number: 9518235Abstract: A microwave plasma based entrained flow gasifier of biomass, including a furnace body and a fuel pretreatment system. The furnace body includes a fuel inlet disposed at the lower part of the furnace body, a syngas outlet disposed at the top of the furnace body, and a slag outlet disposed at the bottom of the furnace body. The fuel inlet presents in the form of nozzles. The fuel pretreatment system is disposed outside of the furnace body, and includes a fuel crushing apparatus, a sieving apparatus disposed downstream to the fuel crushing apparatus, a first fuel container for receiving particle size-qualified fuel, a second fuel container for receiving particle size-unqualified fuel, and a feeding hopper disposed downstream to the first fuel container. The first fuel container and the second fuel container are disposed side-by-side downstream to the sieving apparatus.Type: GrantFiled: June 24, 2014Date of Patent: December 13, 2016Assignee: WUHAN KAIDI ENGINEERING TECHNOLOGY RESEARCH INSTITUTE CO., LTD.Inventors: Yilong Chen, Yanfeng Zhang, Minggui Xia, Liang Zhang
-
Patent number: 9518388Abstract: Construction method for producing beam and slab made of compound concrete containing demolished concrete blocks, comprises that a conventional profiled rebars are made to upper and lower L-shaped stirrups, wherein lower profiled rebar mesh are fixed up firstly, in which coarsely-crushed concrete blocks or segments are placed, then upper profiled rebar mesh are assembled on it together to form a rebar cage, and fresh concrete is poured into the mould fully. A connection portion between the upper and lower L-shaped stirrups is located around ? heights of the lower L-shaped stirrup. A cold rolled rebar mesh is applied to a top rebar mesh of slab; when the bottom rebars of the slab are assembled, coarsely-crushed concrete blocks will be dosed, then the cold rolled rebar mesh will be lifted above the coarsely-crushed concrete blocks for mounting. Finally, fresh concrete is poured into the rebar cage for producing abeam and a space between top rebar mesh and bottom rebars for producing a slab.Type: GrantFiled: February 1, 2016Date of Patent: December 13, 2016Assignees: GUANGZHOU CONSTRUCTION ENGINEERING CO., LTD., SOUTH CHINA UNIVERSITY OF TECHNOLOGYInventors: Long Wang, Bo Wu
-
Patent number: 9517944Abstract: The invention relates to metallurgy, in particular to acidic methods for producing alumina, and can be used in processing low-grade aluminum-containing raw material. The method for producing alumina comprises roasting an aluminum-containing raw material, treating said material with hydrochloric acid, salting out aluminum chloride by saturating the clarified chloride solution with gaseous hydrogen chloride, calcining aluminum chloride to produce aluminum oxide, and pyrohydrolyzing the mother liquor, with the return of hydrogen chloride to the acid treatment and salting out stages.Type: GrantFiled: July 20, 2012Date of Patent: December 13, 2016Assignee: United Company RUSAL Engineering and Technology Centre, LLCInventors: Aleksandr Sergeevich Senyuta, Andrey Vladimirovich Panov
-
Patent number: 9518401Abstract: A system for constructing multi-story building is disclosed. The system can include a plurality of vertical beams and a base beam section. The base beam section can be supported horizontally between the plurality of vertical column members and can include a composite shear connector attached thereto. The framing system can further include a plurality of concrete plank sections spanning perpendicularly to, and supported by, either side of the base beam. The plurality of concrete plank sections can be assembled in pairs. The framing system can also include grout material applied to the composite shear connector and the concrete plank sections to fill the cavities of the assembly to provide an integral framing system. A method for assembling such a system is also disclosed.Type: GrantFiled: October 28, 2014Date of Patent: December 13, 2016Assignee: URBANTECH CONSULTING ENGINEERING, PCInventor: Wei Wang
-
Patent number: 9518625Abstract: To be able to selectively influence the braking effect of a friction brake (1) in a certain operating point to be able to reliably and easily achieve regulation or control of a required setpoint braking effect of the friction brake (1), it is proposed to determine an actuation energy (EE) of the electric motor (21) for the braking operation, and to determine the ascertained actuation energy (EE) as the actual actuation energy (EE_actual) in the predefined setpoint position of the friction brake (1), and to determine a setpoint actuation energy (EE_setpoint) with respect to the setpoint position or with respect to a setpoint braking effect from known data concerning the friction brake (1), and to compensate for a deviation between the actual actuation energy (EE_actual) and the setpoint actuation energy (EE_setpoint) by actuating the friction brake (1).Type: GrantFiled: April 14, 2014Date of Patent: December 13, 2016Assignee: VE VIENNA ENGINEERING FORSCHUNGS-UND ENTWICKLUNGS GMBHInventor: Michael Putz
-
Patent number: 9517715Abstract: A vehicle headlamp system can include a plurality of low beam light sources and a plurality of high beam light sources. In one or more arrangements, the light sources can be light emitting diodes. The system can include a first light driver operatively connected to selectively supply electrical energy to a first group of low beam light sources and/or a first group of high beam light sources. The system can include a second light driver operatively connected to selectively supply electrical energy to a second group of low beam light sources and/or a second group of high beam light sources. The system can further include a controller. The controller can be operatively connected to the first light driver and the second light driver to control the selective supply of electrical energy by the first light driver and the second light driver.Type: GrantFiled: December 20, 2015Date of Patent: December 13, 2016Assignee: Toyota Motor Engineering & Manufacturing North America, Inc.Inventor: Nicholas S. Sitarski
-
Patent number: 9518099Abstract: Disclosed are a folded chlorotoxin, a chlorotoxin variant and a folded chlorotoxin variant and their preparation technology. The folded chlorotoxin has a peptide sequence of MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2, and the folded chlorotoxin variant has a peptide sequence of MCMPCFTTDHQMARSCDDCCGGSGRGSCYGPQCLCR-NH2 and is formed by replacing serine (Ser, S) by lysine (Lys, K) in the peptide sequence of chlorotoxin. The chlorotoxin and its derivatives have potential application values in biological and medical fields and good economic and social benefits to life, health, and personalized healthcare.Type: GrantFiled: September 13, 2015Date of Patent: December 13, 2016Assignee: WENZHOU INSTITUTE OF BIOMATERIALS AND ENGINEERINGInventor: Zhe Liu
-
Patent number: 9520860Abstract: Systems and methods for detecting the failure of a precision time source using an independent time source are disclosed. Additionally, detecting the failure of a GNSS based precision time source based on a calculated location of a GNSS receiver is disclosed. Moreover, the system may be further configured to distribute a time derived from the precision time source as a precision time reference to time dependent devices. In the event of a failure of the precision time source, the system may be configured to distribute a time derived from a second precision time source as the precision time signal during a holdover period.Type: GrantFiled: October 18, 2013Date of Patent: December 13, 2016Assignee: Schweitzer Engineering Laboratories, Inc.Inventors: David E. Whitehead, Shankar V. Achanta, Henry Loehner
-
Patent number: 9520607Abstract: In various aspects, systems and methods are provided for operating a molten carbonate fuel cell assembly at increased power density. This can be accomplished in part by performing an effective amount of an endothermic reaction within the fuel cell stack in an integrated manner. This can allow for increased power density while still maintaining a desired temperature differential within the fuel cell assembly.Type: GrantFiled: March 13, 2014Date of Patent: December 13, 2016Assignee: EXXONMOBIL RESEARCH AND ENGINEERING COMPANYInventors: Paul J. Berlowitz, Timothy Andrew Barckholtz, Anita S. Lee
-
Patent number: 9519301Abstract: Disclosed herein are a variety of systems and methods for management of an electric power generation and distribution system. According to various embodiments, a system consistent with the present disclosure may be configured to analyze a data set comprising a plurality of generator performance characteristics of a generator at a plurality of operating conditions. The performance characteristics may be used to produce a generator capability model. The generator capability model may comprise a mathematical representation approximating the generator performance characteristics at the plurality of operating conditions. The system may further produce an estimated generator capacity at a modeled condition that is distinct from the generator performance characteristics of the data set and is based upon the generator capability model and may implement a control action based on the estimated generator capacity at the modeled condition.Type: GrantFiled: February 26, 2014Date of Patent: December 13, 2016Assignee: Schweitzer Engineering Laboratories, Inc.Inventors: Jedidiah W. Bartlett, William F. Allen
-
Patent number: 9518306Abstract: There is provided a top-firing hot blast stove including a burner and a burner duct capable of stabilizing an ignition point at a desired position inside the burner duct and suppressing occurrence of blinking phenomenon so as to achieve high combustion efficiency. A top-firing hot blast stove 10 includes a checker chamber 4 and a combustion chamber 3 which includes a burner system and placed above the checker chamber 4.Type: GrantFiled: March 13, 2012Date of Patent: December 13, 2016Assignee: Nippon Steel & Sumikin Engineering Co., LtdInventors: Norimasa Maekawa, Koya Inoue, Hiroshi Shimazu, Shunji Koya, Naoki Kunishige, Nobuhiro Ohshita
-
Patent number: 9519837Abstract: A method of tracking a target object in frames of video data includes receiving a first tracking position associated with the target object in a first frame of a video sequence; identifying, for a second frame of the video sequence, a plurality of representation levels and at least one node for each representation level; determining, by a processor, a second tracking position in the second frame by estimating motion of the target object in the second frame between the first frame and the second frame; determining, at each representation level by the processor, a value for each node based on a conditional property of the node in the second frame; and adjusting, by the processor, the second tracking position based on the values determined for each of the nodes and interactions between at least some of the nodes at different representation levels.Type: GrantFiled: July 3, 2014Date of Patent: December 13, 2016Assignees: Toyota Motor Engineering & Manufacturing North America, Inc., University of Technology, SydneyInventors: Xue Mei, Chaohui Wang, Zhibin Hong, Danil V. Prokhorov, Dacheng Tao
-
Patent number: 9518626Abstract: Canted coil spring rings each with a first plurality of coils having first coil major and minor axes; a second plurality of coils each having second coil major and minor axes; the coils of the first plurality of coils alternating with the coils of the second plurality of coils according to an alternating pattern. The spring rings having inner and outer perimeters and wherein the inner perimeter of the spring ring is defined by at least said first plurality of coils. The resulting configuration of the spring ring has improved spacing along the inner perimeter, among others, with respect to a similar canted coil spring ring having a constant coil cross section, such as a coil length with all similar coils.Type: GrantFiled: November 12, 2013Date of Patent: December 13, 2016Assignee: Bal Seal Engineering, Inc.Inventors: Peter J. Balsells, Jin Kim