Abstract: A method for transmitting and receiving an electromagnetic radiation beam, adapted to determine an orbital angular momentum of the received electromagnetic radiation beam, is described. There is further described a system for transmitting and receiving an electromagnetic radiation beam, capable of performing the aforesaid method. A method for performing a telecommunication of signals modulated according to any modulation technique and grouped by means of orbital angular momentum multiplexing is further described. There is further described a telecommunication system capable of performing the aforesaid method for performing a telecommunication of modulated signals.

Abstract: The present disclosure relates to delta-2-tubulin and its use as a biomarker for determining if a subject is at risk of developing peripheral neuropathy or if a subject has developed peripheral neuropathy. The present disclosure further relates to methods for the treatment of peripheral neuropathy in a subject and assays for identifying compounds that can be used to treat and/or prevent peripheral neuropathy.

Abstract: A spectroscopic analysis apparatus may include: a sample holder to retain a gem in analysis position; a first light source configured to emit a first primary beam at an excitation wavelength toward the analysis position to generate emission or diffusion of light; a second light source configured to emit a second primary beam comprising UV light toward the analysis position to impact on the first side; an optical focusing system to focus the light emitted or diffused by the first side in a secondary optical beam; a spectral dispersion device arranged to collect and spatially disperse the secondary optical beam; a first photodetector device arranged to collect the dispersed light and to output a distribution of spectral intensity as a function of emission wavelength; a second photodetector device to collect visible light transmitted through the gem; and a film of fluorescent material to UV light.

Abstract: The present disclosure relates to delta-2-tubulin and its use as a biomarker for determining if a subject is at risk of developing peripheral neuropathy or if a subject has developed peripheral neuropathy. The present disclosure further relates to methods for the treatment of peripheral neuropathy in a subject and assays for identifying compounds that can be used to treat and/or prevent peripheral neuropathy.

Abstract: Disclosed are an antibody able to recognise and specifically bind the CLIC1 protein located on the cell membrane and inhibit its ion channel function; the uses of said antibody in the diagnostic and therapeutic fields; and pharmaceutical compositions containing the antibody.

Abstract: A test bench assembly (10) for the simulation of cardiac surgery and/or interventional cardiology operations and/or procedures, comprising a passive heart (12), wherein said passive heart (12) is an explanted or artificial or hybrid heart, said passive heart (12) having at least one pair of cardiac chambers (14, 16; 114, 116) comprising an atrial chamber (14; 114) and a ventricular chamber (16; 116); a reservoir (20), adapted to house the working fluid; a pressure generator (22), adapted to provide said passive heart (12) pumping said working fluid with the pumping function, said pressure generator (22) being fluidically connected both to said ventricular chamber (16) of said passive heart (12) and to said reservoir (20) by means of first fluid connection means; a pressure regulation device (24) which provides the working fluid in input to the atrial chamber (14) with the preload pressure, and the working fluid in output from the ventricular chamber (16) with the afterload pressure, said pressure regulation d

Abstract: The present invention relates to LSD1 inhibitors for use in the treatment and/or prevention of a viral infection caused by and/or associated with RNA viruses, preferably Coronaviridae. The LSD1 inhibitors are able to inhibit or prevent the viral induced increased expression of inflammatory cytokines while sparing the expression of Interferon and Interferon-Stimulated Genes. The present invention further concerns a combination and a pharmaceutical composition including the molecules or combinations thereof.

Abstract: A test bench assembly for simulating cardiac surgery includes a passive heart having at least one pair of cardiac chambers with an atrial chamber and a ventricular chamber. A reservoir is adapted to house working fluid. A pressure generator fluidically connects both to the ventricular chamber of the passive heart and to the reservoir. A pressure regulation device provides working fluid in input to the atrial chamber with preload pressure, and working fluid in output from the ventricular chamber with afterload pressure. The pressure regulation device fluidically connects both to the atrial chamber of the passive heart and to the ventricular chamber of the passive heart. The pressure regulation device has a single compliant element for each pair of cardiac chambers, which provides working fluid with both preload, and afterload pressures.

Abstract: Disclosed is the production by fermentation of poly D-lactic acid (PDLA) and poly L-lactic acid (PLLA). In particular, there is provided engineered (prokaryotic or eukaryotic) cells for the direct synthesis of PLLA polymers and engineered eukaryotic cells for the direct synthesis of PDLA polymers starting from a carbon source, including residual biomasses of the different production chains.

Abstract: The subject of the present invention is a peptide, natural or synthetic, which comprises an amino acid sequence that has at least 80% sequence identity with the sequence SDRSLHLEANEKGENVNVHVTKTRADKSKIKVSVRQYADINEKGEAQYKCP-VAQLE (SEQ ID NO: 1). A further object of the present invention is said peptide which has at least 80% sequence identity with the sequence SEQ ID NO: 1 which is a JNK3 inhibitor for use in the prevention and / or treatment of neurodegenerative or neurodevel-opmental diseases.

Abstract: A writing instrument that includes a writing element for depositing a writing material on a support and a plurality of sensors including at least a force sensor and a movement sensor, a communication unit that exchanges data with a remote device a control unit connected to the sensors and to the communication unit in order to transmit to the remote device the measurements provided by the sensors, a memory unit connected to the control unit that stores one or more measurements from the sensors; and a hollow casing that contains at least part of the writing element so that the writing end is exposed, and also houses the sensors, the control unit, the memory unit and the communication unit.

Abstract: A device for simulating injections of liquid chemical/cementitious substances into soils, comprising a first observation chamber which delimits an injectable space adapted to accommodate a soil sample, a second observation chamber which delimits a perforation space adapted to accommodate at least one stretch of an injection device, with longitudinal extension along a longitudinal axis of the second observation chamber, wherein the first observation chamber and the second observation chamber are directly bordering to each other in an interface area, a retaining partition wall which can be inserted in the interface area so as to separate the injectable space from the perforation space and extracted so as to put the perforation space into communication with the injectable space, as well as first transparent portions formed in a first containment wall of the first observation chamber for viewing in real time a propagation of the chemical substance injected into the soil sample by means of the injection device.

Abstract: A sensitized composite scintillator which optionally interacts with ionizing radiation is provided having a vitreous or plastic matrix in which there are incorporated perovskite nanostructures which sensitize light emitters.

Abstract: The present invention relates to a liposome containing a lipid or lipid mixture, phosphatidic acid and/or cardiolipin and apolipoprotein E for use in the treatment and/or prevention of amyloidosis, wherein the amyloidosis is not Alzheimer's disease and pharmaceutical compositions containing the same.

Abstract: The present invention relates to iPSC produced from fibroblast obtained from a subject affected by a neurodevelopmental disorder entailing intellectual disability (ID) and/or a disorder belonging to the Autism Spectrum Disorder (ASD) and/or Schizophrenia (SZ) and uses thereof. The present invention also relates to a cortical neural progenitor cell or a terminally differentiated cortical glutamatergic or gabaergic neuronal cell or a neural crest stem cell line, a mesenchymal stem cell line produced from the iPSC or iPSC line. The invention also relates to method for identifying a compound for the treatment and/or prevention of a neurodevelopmental disorder entailing intellectual disability (ID) and/or a disorder belonging to the Autism Spectrum Disorder (ASD) and/or Schizophrenia (SZ) and to a LSD1 inhibitor or a HDAC2 inhibitor for use in the treatment of such disorders.

Abstract: The present invention relates to an inhibitor of miR-129, relative compounds and pharmaceutical compositions for use in the treatment and/or prevention of amyotrophic lateral sclerosis and Alzheimer's disease. The invention also relates to a method for the diagnosis and/or prognosis of Alzheimer's disease in a subject or to identify a subject at risk to develop amyotrophic lateral sclerosis or Alzheimer's disease and to a method for the measuring the efficacy of a therapy for amyotrophic lateral sclerosis or for Alzheimer's disease and relative kits.

Abstract: A test bench assembly for simulating cardiac surgery includes a passive heart having at least one pair of cardiac chambers with an atrial chamber and a ventricular chamber. A reservoir is adapted to house working fluid. A pressure generator fluidically connects both to the ventricular chamber of the passive heart and to the reservoir. A pressure regulation device provides working fluid in input to the atrial chamber with preload pressure, and working fluid in output from the ventricular chamber with afterload pressure. The pressure regulation device fluidically connects both to the atrial chamber of the passive heart and to the ventricular chamber of the passive heart. The pressure regulation device has a single compliant element for each pair of cardiac chambers, which provides working fluid with both preload, and afterload pressures.

Abstract: An implantable medical device obtained by means of two-photon laser polymerisation of a resin to form a three-dimensional matrix, wherein: said three-dimensional matrix comprises a number of levels distributed in height; and said three-dimensional matrix comprises reference means designed to uniquely identify the height of each level from a pre-set reference, by means of a multi-photon fluorescence-excitation microscope; said implantable medical device being characterised in that said reference means comprise a solid having a cross section that varies with height.

Abstract: A test bench assembly for simulating cardiac surgery includes a passive heart having at least one pair of cardiac chambers with an atrial chamber and a ventricular chamber. A reservoir is adapted to house working fluid. A pressure generator fluidically connects both to the ventricular chamber of the passive heart and to the reservoir. A pressure regulation device provides working fluid in input to the atrial chamber with preload pressure, and working fluid in output from the ventricular chamber with afterload pressure. The pressure regulation device fluidically connects both to the atrial chamber of the passive heart and to the ventricular chamber of the passive heart. The pressure regulation device has a single compliant element for each pair of cardiac chambers, which provides working fluid with both preload, and afterload pressures.

Abstract: A glass brick having a luminescent solar concentrator inserted inside it, between the preformed glass portions which constitute the body of the glass brick is provided.