Abstract: Oligosaccharides are for use in the treatment of neurodegenerative diseases of the central nervous system, in particular Parkinson's disease, and to pharmaceutical compositions including one or more of the oligosaccharides.

Abstract: The present invention relates to refined prognostic clinical tools, methods, and kits for the evaluation of risk and treatment of distant recurrence in ER+/HER2? breast cancer patients.

Abstract: A test bench assembly (10) for the simulation of cardiac surgery and/or interventional cardiology operations and/or procedures, comprising a passive heart (12), wherein said passive heart (12) is an explanted or artificial or hybrid heart, said passive heart (12) having at least one pair of cardiac chambers (14, 16; 114, 116) comprising an atrial chamber (14; 114) and a ventricular chamber (16; 116); a reservoir (20), adapted to house the working fluid; a pressure generator (22), adapted to provide said passive heart (12) pumping said working fluid with the pumping function, said pressure generator (22) being fluidically connected both to said ventricular chamber (16) of said passive heart (12) and to said reservoir (20) by means of first fluid connection means; a pressure regulation device (24) which provides the working fluid in input to the atrial chamber (14) with the preload pressure, and the working fluid in output from the ventricular chamber (16) with the afterload pressure, said pressure regulation d

Abstract: Disclosed is a method for evaluating residual platelet thrombotic potential in patients undergoing antiplatelet treatment, which comprises determination in a patient's blood sample of vasodilator-stimulated phosphoprotein phosphorylation (VASP-P) status and platelet tissue factor (TF) expression.

Abstract: A method for demultiplexing and demodulating (in particular, “locally” demultiplexing and demodulating) amplitude-modulated signals grouped by means of orbital angular momentum multiplexing is described. The method involves demultiplexing and demodulating information a(t), b(t) modulated on each of a first modulated beam Fm1 and at least one second modulated beam Fm2, based on phase difference values ?Pab and ?R detected by beam detectors located downstream of an interferometric structure 40 to which two portions of the electromagnetic beam carrying the modulated channels are provided as inputs, multiplexed in the orbital angular momentum variable. There is also described a corresponding system 100 for demultiplexing and demodulating amplitude-modulated signals capable of implementing the aforesaid method.

Abstract: The disclosure is directed to pharmaceutical compositions for oral administration in form of coated tablets that exhibit modified release properties when administered as either whole or half tablets. In particular, the disclosure is directed to modified release tablets comprising deferiprone, said tablets being suitable for twice daily oral administration. The disclosure is also directed to methods of making and using the same.

Abstract: The disclosure is directed to pharmaceutical compositions for oral administration comprising deferiprone. In particular, the disclosure is also directed to modified release tablets suitable either for twice daily administration or once daily administration. The disclosure is also directed to methods of making and using the same.

Abstract: A writing instrument that includes a writing element for depositing a writing material on a support and a plurality of sensors including at least a force sensor and a movement sensor, a communication unit that exchanges data with a remote device a control unit connected to the sensors and to the communication unit in order to transmit to the remote device the measurements provided by the sensors, a memory unit connected to the control unit that stores one or more measurements from the sensors; and a hollow casing that contains at least part of the writing element so that the writing end is exposed, and also houses the sensors, the control unit, the memory unit and the communication unit.

Abstract: The present invention relates to a vaccine composition comprising a host cell belonging to the genus Leishmania, wherein the host cell comprises a polynucleotide coding for at least one protein of a virus belonging to the family Coronaviridae. Furthermore, the invention relates to the medical and veterinary use of the vaccine composition and to a process for preparing the vaccine composition.

Abstract: A method for transmitting and receiving an electromagnetic radiation beam, adapted to determine an orbital angular momentum of the received electromagnetic radiation beam, is described. There is further described a system for transmitting and receiving an electromagnetic radiation beam, capable of performing the aforesaid method. A method for performing a telecommunication of signals modulated according to any modulation technique and grouped by means of orbital angular momentum multiplexing is further described. There is further described a telecommunication system capable of performing the aforesaid method for performing a telecommunication of modulated signals.

Abstract: The present disclosure relates to delta-2-tubulin and its use as a biomarker for determining if a subject is at risk of developing peripheral neuropathy or if a subject has developed peripheral neuropathy. The present disclosure further relates to methods for the treatment of peripheral neuropathy in a subject and assays for identifying compounds that can be used to treat and/or prevent peripheral neuropathy.

Abstract: The present disclosure relates to methods of treating cancer and pharmaceutical compositions for use in the treatment of cancer, including LSD1-inhibitor-resistant cancers, comprising administering to a subject an effective amount of a cell cycle inhibitor, such as a CDK4/6 inhibitor or a p21 enhancer, and an effective amount of a LSD1 inhibitor.

Abstract: A spectroscopic analysis apparatus may include: a sample holder to retain a gem in analysis position; a first light source configured to emit a first primary beam at an excitation wavelength toward the analysis position to generate emission or diffusion of light; a second light source configured to emit a second primary beam comprising UV light toward the analysis position to impact on the first side; an optical focusing system to focus the light emitted or diffused by the first side in a secondary optical beam; a spectral dispersion device arranged to collect and spatially disperse the secondary optical beam; a first photodetector device arranged to collect the dispersed light and to output a distribution of spectral intensity as a function of emission wavelength; a second photodetector device to collect visible light transmitted through the gem; and a film of fluorescent material to UV light.

Abstract: The present disclosure relates to delta-2-tubulin and its use as a biomarker for determining if a subject is at risk of developing peripheral neuropathy or if a subject has developed peripheral neuropathy. The present disclosure further relates to methods for the treatment of peripheral neuropathy in a subject and assays for identifying compounds that can be used to treat and/or prevent peripheral neuropathy.

Abstract: Disclosed are an antibody able to recognise and specifically bind the CLIC1 protein located on the cell membrane and inhibit its ion channel function; the uses of said antibody in the diagnostic and therapeutic fields; and pharmaceutical compositions containing the antibody.

Abstract: A test bench assembly (10) for the simulation of cardiac surgery and/or interventional cardiology operations and/or procedures, comprising a passive heart (12), wherein said passive heart (12) is an explanted or artificial or hybrid heart, said passive heart (12) having at least one pair of cardiac chambers (14, 16; 114, 116) comprising an atrial chamber (14; 114) and a ventricular chamber (16; 116); a reservoir (20), adapted to house the working fluid; a pressure generator (22), adapted to provide said passive heart (12) pumping said working fluid with the pumping function, said pressure generator (22) being fluidically connected both to said ventricular chamber (16) of said passive heart (12) and to said reservoir (20) by means of first fluid connection means; a pressure regulation device (24) which provides the working fluid in input to the atrial chamber (14) with the preload pressure, and the working fluid in output from the ventricular chamber (16) with the afterload pressure, said pressure regulation d

Abstract: The present invention relates to LSD1 inhibitors for use in the treatment and/or prevention of a viral infection caused by and/or associated with RNA viruses, preferably Coronaviridae. The LSD1 inhibitors are able to inhibit or prevent the viral induced increased expression of inflammatory cytokines while sparing the expression of Interferon and Interferon-Stimulated Genes. The present invention further concerns a combination and a pharmaceutical composition including the molecules or combinations thereof.

Abstract: A test bench assembly for simulating cardiac surgery includes a passive heart having at least one pair of cardiac chambers with an atrial chamber and a ventricular chamber. A reservoir is adapted to house working fluid. A pressure generator fluidically connects both to the ventricular chamber of the passive heart and to the reservoir. A pressure regulation device provides working fluid in input to the atrial chamber with preload pressure, and working fluid in output from the ventricular chamber with afterload pressure. The pressure regulation device fluidically connects both to the atrial chamber of the passive heart and to the ventricular chamber of the passive heart. The pressure regulation device has a single compliant element for each pair of cardiac chambers, which provides working fluid with both preload, and afterload pressures.

Abstract: Disclosed is the production by fermentation of poly D-lactic acid (PDLA) and poly L-lactic acid (PLLA). In particular, there is provided engineered (prokaryotic or eukaryotic) cells for the direct synthesis of PLLA polymers and engineered eukaryotic cells for the direct synthesis of PDLA polymers starting from a carbon source, including residual biomasses of the different production chains.

Abstract: The subject of the present invention is a peptide, natural or synthetic, which comprises an amino acid sequence that has at least 80% sequence identity with the sequence SDRSLHLEANEKGENVNVHVTKTRADKSKIKVSVRQYADINEKGEAQYKCP-VAQLE (SEQ ID NO: 1). A further object of the present invention is said peptide which has at least 80% sequence identity with the sequence SEQ ID NO: 1 which is a JNK3 inhibitor for use in the prevention and / or treatment of neurodegenerative or neurodevel-opmental diseases.