Patents Examined by Karlheinz R. Skowronek
  • Cyclic peptides with an anti-parasitic activity
    Patent number: 9133237
    Abstract: The present invention relates to a method for preparing a cyclic peptide with antiparasite activity and anticancer activity. The invention also relates to this peptide as an antiparasite agent, for example in the treatment of toxoplasmosis and as an anticancer agent. The invention also relates to the use of this cyclic peptide for treating organs ex vivo before transplantation.
    Type: Grant
    Filed: April 6, 2010
    Date of Patent: September 15, 2015
    Assignees: UNIVERSITE JOSEPH FOURIER (GRENOBLE 1), CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE, (INSERM) INSTITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE
    Inventors: Yung-Sing Wong, Mohamed-Ali Hakimi, Alexandre Bougdour, Hervé Pelloux, Danièle Maubon
  • Pharmaceutical compositions comprising angiotensin-(1-9), derivatives thereof, or a vector expressing ACE2, useful for treating cardiovascular, pulmonary, cerebral, and/or renal remodeling
    Patent number: 9132164
    Abstract: A pharmaceutical composition is provided having an effective amount of angiotensin-(1-9) and at least one pharmaceutical acceptable carrier, excipient, stabilizer, diluent, and/or adjuvant. Also provided is a method of using the pharmaceutical composition for inhibiting and/or reducing cardiovascular remodeling.
    Type: Grant
    Filed: December 15, 2009
    Date of Patent: September 15, 2015
    Assignees: PONTIFICIA UNIVERSIDAD CATOLICA DE CHILE, UNIVERSIDAD DE CHILE
    Inventors: María Paz Ocaranza Jeraldino, Sergio Lavandero González, Jorge Jalil Milad, Mario Chiong Lay
  • Methods of making and using surfactant polymers
    Patent number: 9125969
    Abstract: Comblike, surfactant polymers for changing the surface properties of biomaterials are provided. Such surfactant polymers comprise a polymeric backbone of repeating monomeric units having functional groups for coupling with side chains, a plurality of hydrophobic side chains linked to the backbone via the functional groups, and a plurality of hydrophilic side chains linked to said backbone via the functional groups. Medical devices coated with the surfactant polymers are also provided. The surfactant polymers may be used to decrease the thrombogenic properties, encapsulation, and bacterial colonization of medical devices.
    Type: Grant
    Filed: March 16, 2012
    Date of Patent: September 8, 2015
    Assignee: NANOMIMETICS, INC.
    Inventors: Jan J. Lewandowski, Yubiao Liu, Roger Marchant, Tianhong Zhang, Yongxing Qiu, Mark A. Ruegsegger
  • Analgesic active peptide VGG, preparation and use thereof
    Patent number: 9127075
    Abstract: The present invention provides an active peptide purified from scorpions, and derivatives, analogs and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below: VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.
    Type: Grant
    Filed: July 5, 2011
    Date of Patent: September 8, 2015
    Assignee: SHENYANG PHARMACEUTICAL UNIVERSITY
    Inventors: Jianhai Zhang, Zhou Yang, Yanfeng Liu, Chunfu Wu
  • Plasminogen and plasmin variants
    Patent number: 9121014
    Abstract: The invention relates to variants of plasminogen and plasmin comprising one or more point mutations in the catalytic domain which reduce or prevent autocatylic destruction of the protease activity plasmin. Compositions, uses and methods of using said variants of plasminogen and plasmin are also disclosed.
    Type: Grant
    Filed: January 4, 2012
    Date of Patent: September 1, 2015
    Assignee: ThromboGenies NV
    Inventor: Richard Reinier Zwaal
  • Therapy and prevention of problem drinking
    Patent number: 9119805
    Abstract: The present invention provides methods for the therapy and prevention of problem drinking in alcohol-dependent and non-dependent subjects and those at risk of developing problem drinking behavior, and compositions of matter comprising oxytocin or an analog or derivative thereof or an agonist or partial agonist of an oxytocin receptor that are useful in preventing or treating problem drinking.
    Type: Grant
    Filed: September 29, 2010
    Date of Patent: September 1, 2015
    Assignee: THE UNIVERSITY OF SYDNEY
    Inventors: Iain Stewart McGregor, Dean Samuel Carson, Adam John Guastella, Michael Thomas Bowen
  • Non-aqueous synthesis of polysaccharide-protein conjugates for vaccines
    Patent number: 9120848
    Abstract: The invention is a novel chemical coupling methodology for the synthesis of a stable polysaccharide-protein conjugates as the immunogenic component for vaccines. A covalent bond is formed between polysaccharide and protein in the dry state in the absence of water and oxygen. A polysaccharide antigen is covalently linked to the protein by activating the polysaccharide with periodate to introduce aldehyde groups into the polysaccharide, lyophilizing an aqueous mixture of a protein and activated polysaccharide, sealing the dry lyophilized mixture in a vessel under vacuum or inert gas and then incubating the sealed vessel at an elevated temperature.
    Type: Grant
    Filed: September 22, 2011
    Date of Patent: September 1, 2015
    Inventor: Harvey Kaplan
  • Non-digestible oligosaccharides for oral induction of tolerance against dietary proteins
    Patent number: 9119838
    Abstract: Compositions and methods for providing infant nutrition with partially hydrolysed proteins and non-digestible oligosaccharides for use in induction of oral tolerance against native dietary proteins.
    Type: Grant
    Filed: June 1, 2011
    Date of Patent: September 1, 2015
    Assignee: N.V. NUTRICIA
    Inventors: Léon Mathieu Johannes Knippels, Elisabeth Catharina Adriana Maria Van Esch, Johan Garssen
  • CCN3 and CCN3 peptides and analogs thereof for therapeutic uses
    Patent number: 9114112
    Abstract: The present invention provides a method for treating a human patient with a pathology by administering to the subject an effective amount of an agent selected from the group of: native full-length CCN3 proteins; analog CCN3 full-length proteins with native cysteine residues substituted by a replacement amino acid; CCNp native peptide fragments having from about 12 to about 20 amino acids; analog CCNp peptide fragments with native cysteine residues substituted with a replacement amino acid; and combinations thereof.
    Type: Grant
    Filed: December 21, 2012
    Date of Patent: August 25, 2015
    Assignee: Rosalind Franklin University of Medicine and Science
    Inventor: Bruce Leigh Riser
  • Method for the preparation of a nucleic acid library
    Patent number: 9115352
    Abstract: The present invention is related to a method for preparing a nucleic acid library comprising a plurality of various elements or nucleic acid molecules that differ in a controlled manner at one or several distinct nucleotide positions.
    Type: Grant
    Filed: March 30, 2009
    Date of Patent: August 25, 2015
    Assignee: Sloning BioTechnology GmbH
    Inventors: Jan Van den Brulle, Markus Fuhrmann, Ralf Strohner
  • Synthetic platelets
    Patent number: 9107845
    Abstract: A synthetic platelet includes a biocompatible flexible nanoparticle that includes an outer surface and a plurality of peptides conjugated to the surface, the peptides including a plurality of von Willebrand factor-binding peptides (VBPs), collagen-binding peptides (CBPs) and an active platelet GPIIb-IIIa-binding peptides (GBPs).
    Type: Grant
    Filed: April 13, 2012
    Date of Patent: August 18, 2015
    Assignee: CASE WESTERN RESERVE UNIVERSITY
    Inventors: Anirban Sen Gupta, Madhumitha Ravikumar
  • Bio-pin
    Patent number: 9110059
    Abstract: A bio-pin is provided. The bio-pin can be used for cell transfer and treatment, cell tracing, and targeting of specific tissues and cells using a peptide-based complex in which a cell-penetrating peptide or a cell-adhesive peptide is bound to one or both ends of a cell membrane protein, and used in a molecular imaging system, a medical appliance, and the like.
    Type: Grant
    Filed: March 15, 2012
    Date of Patent: August 18, 2015
    Assignee: Industry-Academic Cooperation Foundation, Yonsei University
    Inventors: Ji Hyung Chung, Yang Soo Jang
  • Angiotensin peptides in treating marfan syndrome and related disorders
    Patent number: 9107870
    Abstract: The present invention provides, among other things, methods of treating Marfan Syndrome and/or a Marfan-related disorder including administering to a subject suffering from or susceptible to Marfan Syndrome and/or a Marfan-related disorder an angiotensin (1-7) peptide. In some embodiments, the angiotensin (1-7) peptide is administered at an effective dose periodically at an administration interval such that at least one symptom or feature of Marfan Syndrome and/or a Marfan-related disorder is reduced in intensity, severity, duration, or frequency or has delayed in onset.
    Type: Grant
    Filed: October 3, 2014
    Date of Patent: August 18, 2015
    Assignee: Tarix Phamaceuticals Ltd.
    Inventor: Richard Franklin
  • Template-fixed peptidomimetics with CXCR7 modulating activity
    Patent number: 9109009
    Abstract: Novel template-fixed ?-hairpin peptidomimetics of the general formula (I), wherein the single elements T or P are ?-amino acid residues connected from the carbonyl (C?O) point of attachment to the nitrogen (N) of the next element in clockwise direction and wherein said elements, depending on their positions in the chain, are defined in the description and the claims have the property to act on the receptor CXCR7. Thus, these ?-hairpin peptidomimetics can be useful in the treatment or prevention of diseases or conditions in the area of dermatological disorders, metabolic diseases, inflammatory diseases, fibrotic diseases, infectious diseases, neurological diseases, cardiovascular diseases, respiratory diseases, gastro-intestinal tract disorders, urological diseases, ophthalmic diseases, stomatological diseases, haematological diseases and cancer; or the mobilization of stem cells.
    Type: Grant
    Filed: February 4, 2011
    Date of Patent: August 18, 2015
    Assignee: POLYPHOR AG
    Inventors: Frank Otto Gombert, Alexander Lederer, Ralf Löwe, Daniel Obrecht, Barbara Romagnoli, Johann Zimmermann, Kalpana Patel
  • Inhibition of tumor growth
    Patent number: 9109048
    Abstract: The present invention provides a cytotoxic 7 to 25 mer peptide with three or more cationic residues which has one or more non-genetic bulky and lipophilic amino acids, as well as esters, amides, salts and cyclic derivatives thereof as well as methods of preparing the peptides, pharmaceutical compositions containing them and their use as medicaments, particularly as antibacterions or antitumoral agents. In a preferred aspect, the invention provides the use of said peptides in a method of inducing adaptive immunity against tumor growth or establishment in a subject, as well as the use of other lytic agents in a method of inducing adaptive immunity in a subject.
    Type: Grant
    Filed: August 14, 2012
    Date of Patent: August 18, 2015
    Assignee: LYTIX BIOPHARMA AS
    Inventors: Liv Tone Eliassen, Gerd Berge, Baldur Sveinbjørnsson, John Sigurd Svendsen, Øystein Rekdal
  • Heteromultivalent nanoparticle compositions
    Patent number: 9107963
    Abstract: A composition for use in diagnostic and therapeutic applications includes a heteromultivalent nanoparticle having an outer surface and a plurality of targeting moieties conjugated to the surface of the nanoparticle, the targeting moieties includes a first activated platelet targeting moiety and a second activated platelet targeting moiety.
    Type: Grant
    Filed: April 15, 2013
    Date of Patent: August 18, 2015
    Assignee: Case Western Reserve University
    Inventors: Anirban Sen Gupta, Madhumitha Ravikumar, Christa Modery
  • Secondary structure stabilized NMDA receptor modulators and uses thereof
    Patent number: 9101612
    Abstract: Disclosed are compounds having enhanced potency in the modulation of NMDA receptor activity. Such compounds are contemplated for use in the treatment of diseases and disorders such as learning, cognitive activities, and analgesia, particularly in alleviating and/or reducing neuropathic pain.
    Type: Grant
    Filed: February 11, 2011
    Date of Patent: August 11, 2015
    Assignee: Northwestern University
    Inventors: Joseph Moskal, M. Amin Khan
  • Compositions for enhancing nail growth
    Patent number: 9101550
    Abstract: The present invention is directed to compositions and methods for stimulating the growth of nails and cuticles in a mammal, including humans. The compositions may be administered topically to the nail bed, nail matrix and cuticle in an amount effective to increase nail growth and thicken, strengthen and smooth the nail. The composition is also effective in strengthening and growing nails, including fingernails and toenails.
    Type: Grant
    Filed: January 22, 2013
    Date of Patent: August 11, 2015
    Assignee: Allergan, Inc.
    Inventors: Scott M. Whitcup, Rhett M. Schiffman, John G. Walt, Debbie D. Mullins, Connie M. Stucker
  • Immunomodulatory compositions and methods for treating disease with modified host defense peptides
    Patent number: 9102754
    Abstract: Compositions and methods are provided for modulating an immune response in a vertebrate subject. Compositions and methods can comprise administering a modified host defense peptide to the vertebrate subject in an amount effective to activate the immune response in the vertebrate subject, wherein the modified host defense peptide is inverted in amino acid sequence from an amino terminus to a carboxy terminus or modified to one or more D-amino acids, or both modifications, when compared to a host defense peptide. Compositions and methods are provided which comprise administering a modified host defense peptide to the vertebrate subject in an amount effective to modify an immune response in the vertebrate subject.
    Type: Grant
    Filed: June 27, 2008
    Date of Patent: August 11, 2015
    Assignee: University of Saskatchewan
    Inventors: Scott Kirk Napper, Kenneth Jason Kindrachuk, Samuel Kwadwo Attah-Poku
  • Cell-protective peptides and uses thereof
    Patent number: 9096643
    Abstract: A peptide comprising the amino acid sequence, X1X2RX3DX4X5X6X7 is provided, as well as a biomaterial comprising the peptide for use to treat conditions resulting from cell death or apoptosis.
    Type: Grant
    Filed: August 26, 2011
    Date of Patent: August 4, 2015
    Inventors: Milica Radisic, Susan Dallabrida, Maria Ann Rupnick