Abstract: The present invention relates, inter alia, to certain hepcidin peptide analogues, including peptides and dimers thereof, and to the use of the peptides and peptide dimers in the treatment and/or prevention of a variety of diseases, conditions or disorders, including treatment and/or prevention of iron overload diseases, which include hereditary hemochromatosis and iron-loading anemias, and other conditions and disorders described herein.

Abstract: As disclosed herein, inhibition of the ornithine decarboxylase 1-driven pathway can restore immunotherapeutic efficacy in lung cancer with lost STK11 function. Therefore, disclosed herein are compositions and methods for treating a lung cancer in a subject using an ornithine decarboxylase (ODC) inhibitor, such as difluoromethylornithine. In particular, disclosed is a method for using an ODC inhibitor to sensitize a lung cancer to immunotherapy. The method can involve assaying the subject for STK11 function. The method can also involve treating the subject with an immunotherapy, such as anti-PD-1/PD-L1 immunotherapy.

Abstract: Compositions and methods for the promotion of wound healing and tissue regeneration are described. The compositions and methods make use of water-soluble soy protein isolates (WSsoy), Fraction 5, Fraction 9, and/or bioactive peptide components of soy protein isolates. The invention also relates to the unexpected discovery that purified WSsoy forms gel-like matrices when suspended within certain concentration ranges in an aqueous environment. The compositions of the invention comprising WSsoy promote natural healing and have a low risk profile.

Abstract: A hook fusion protein, which includes a hook domain and at least one cytoplasmic carboxyl endoplasmic reticulum (ER) retention signal and/or at least one cytoplasmic amino terminal endoplasmic reticulum (ER) retention signal; wherein the hook fusion protein is a soluble protein that localizes in the cytoplasm. Also, a nucleic acid system for intracellular targeting control including a nucleic acid encoding a target fusion protein including a hook fusion protein, and a nucleic acid encoding a target fusion protein including a hook-binding domain; wherein the target fusion protein is a membrane protein; and wherein the hook fusion protein localizes in the ER when bound to the target fusion protein. Additionally, a vector system, viral particle system, host cell and kit include these nucleic acids. Further, the vector system, viral particle system, host cell or kit for use as a medicament, in particular for immunotherapy.

Abstract: Compositions and methods are presented that allow for an enhanced immune response against a GPI-anchored tumor associated antigen by modification of the protein portion of the TAA to include a transmembrane domain and a trafficking signal that directs the modified protein to the endosomal or lysosomal compartment. Most preferably, the modified protein will no longer have a GPI anchor or GPI attachment sequence.

Abstract: The invention provides inter alia an aqueous solution composition of pH in the range 6.0 to 8.0 comprising: —daptomycin or an analogue thereof, or a salt thereof; —a divalent metal cation; and —one or more salts which are not divalent metal cation salts or amino acid salts or buffer salts at a total concentration of 300 mM or more.

Abstract: Disclosed herein are surfactant peptide nanostructures wherein the peptides have repeating hydrophobic amino acids in an integer equal to or less than four. The peptide nanostructures are useful for therapeutic applications, including for delivery of drugs and siRNA.

Abstract: The present invention relates to a method of necrosing, causing membranolysis, or causing poration of selective cancer cells. In some aspects, the method includes administering a peptide including PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG (SEQ ID NO:48) or ETFSDLWKLLKKWKMRRNQFWVKVQRG (SEQ ID NO:49) to a selective cancer cell to cause necrosis, membranolysis, or poration of said selective cancer cell.

Abstract: Provided are an upstream Open Reading Frame (uORF) of a Phosphatase and Tensin homolog (PTEN) gene and a protein coded by the uORF. A potential ORF of 138 bases (45aa-uORF) in the 5?UTR of the PTEN, coding an oligopeptide of 45 amino acids (named PTEN-45aa) plays an important role in the development and progression progress of tumors. Further provided are a new diagnostic and therapeutic method and a drug screening platform for PTEN expression regulation related diseases, in particular neuroglioma. Also provided is a polypeptide for treatment of PTEN expression regulation related diseases.

Abstract: A polypeptide-coupled small molecule compound and its antiviral applications are provided. The polypeptide-coupled small molecule compound is obtained by linking a polypeptide with a sequence X?nLXGG and a small molecule compound capable of inhibiting activity of papain-like protease (PLpro) of coronavirus through a chemical bond. The polypeptide with the sequence X?nLXGG is a polypeptide with a sequence LXGG at its carboxyl terminal, X and X? are independently any amino acid, and n is an integer between 1-50. The structure of the small molecule compound capable of inhibiting the activity of PLpro contains an amino group or a hydroxyl group. The polypeptide-coupled small molecule compound can inhibit the PLpro of SARS-CoV-2 in a targeted manner, thereby inhibiting the polyprotein cleavage of coronavirus in the host, and achieving the purpose of inhibiting the replication of coronavirus in the host. It has the advantages of synergistic inhibition, low cytotoxicity and favorable solubility.

Abstract: Inert matrices for use with ?-synuclein seed amplification assays (?S-SAAs) are provided. The inert matrices accurately reflect the absence of misfolded ?S protein when used as a negative control, in the form of no, perceptively low, or delayed ?S substrate self-aggregation, yet will readily permit aggregation of the ?S substrate with seeds when used as a positive control. The inert matrices may be used to screen for ?S-SAA reagent competence. The inert matrices may be used to dilute samples taken from peripheral biological matrices. Finally, the inert matrices may be used as a diluent for serial dilutions of ?S-SAA samples, to enable semi-quantitative versions of ?S-SAAs.

Abstract: Treatment of hyperinsulinemic hypoglycemia comprises administration of an effective amount of a glucagon-like peptide-1 receptor antagonist (GLP1RA) alone or in combination with an amylinomimetic agent or any anti-gastric emptying agent. Patients suffering from hyperinsulinemic hypoglycemia after bariatric surgery experience particular benefit, as there is no current method effective for their treatment. Prevention or reduction of acute adverse effects of postprandial hypoglycemia, such as palpitations, tremor, weakness, sweating, confusion, fatigue, blurred vision, seizures, or loss of consciousness, and prevention of chronic adverse effects of hyperinsulinemic hypoglycemia, such as cognitive impairment, can be achieved by treatment with GLP1RA.

Abstract: A use of lactoferrin in the preparation of a food or drug, the food or drug being used for activating a VDR signaling pathway, which is used for the treatment of bone disease, bone disease comprising: osteoporosis, bone damage, loss of bone calcium, incomplete bone development and bone abnormalities. The present invention further comprises screening for drugs that are used to promote osteoblast proliferation and differentiation by using an active state of the VDR signaling pathway.

Abstract: The present invention covers an isolated T cell receptor (TCR) specific for one allelic variant of minor histocompatibility antigen 1 (HA-1), in particular the allelic variant HA-1H. An isolated polypeptide comprising a functional portion of the TCR is also described. Moreover, a multivalent TCR complex, nucleic acid molecules, vectors, cells, antibodies as well as medical uses that relate to the TCR are defined.

Abstract: Novel cyclic peptides, cyclic peptide conjugates and compositions containing them for treating neurological diseases in a subject include an Odorranalectin (OL) sequence or modified OL sequence as a scaffold and a biologically active peptide or protein and/or therapeutic agent conjugated thereto. Methods of treatment of neurological diseases are based on intranasal delivery of a cyclic peptide or cyclic peptide conjugate as described herein. Combinatorial libraries that include a plurality of cyclic peptides have also been developed and can be used to screen for a ligand(s) for a receptor of interest.

Abstract: The present invention pertains to: a marker composition for diagnosing atherosclerosis severity; a composition for diagnosing atherosclerosis severity; an atherosclerosis severity diagnosis kit including the composition; a method for screening substances for preventing or treating atherosclerosis; and a method for providing information about a diagnosis of atherosclerosis severity, wherein LGI3 expression or activity levels are used. According to the present invention, the severity of atherosclerosis can be diagnosed or predicted, and personalized medicine and predictive medicine can be practiced using such information. Moreover, the present invention can treat atherosclerosis without affecting other metabolic phenotypes by administering an LGI3 antagonist.

Abstract: The present invention refers to a pharmaceutical composition comprising (a) lixisenatide or/and a pharmaceutically acceptable salt thereof, and (b) insulin glargine or/and a pharmaceutically acceptable salt thereof, wherein the compound (b) and compound (a) are present in a fixed ratio.

Abstract: The present disclosure relates to novel cell penetrating peptides and their applications in cosmetic compositions. These compositions include cell penetrating botulinum toxin recombinant proteins, which are fusion proteins of the cell-penetrating peptides and botulinum toxin. Also disclosed are polynucleotides encoding these recombinant proteins and recombinant expression vectors comprising these polynucleotides. The cell penetrating botulinum toxin recombinant proteins serve as active ingredients in the cosmetic compositions.

Abstract: Disclosed herein are circular zymogens of RNase 1 that have a proteolytic cleavage site and are activated by a specific protease. These circular zymogens are useful for treatment of disorders that are characterized by a specific protease (e.g., HTV-1 protease).

Abstract: The disclosure provides compositions and methods for treating, ameliorating, and/or preventing a vaso-occlusive crisis (VOC) in a subject suffering from sickle cell disease (SCD). The disclosure also provides compositions and methods for treating, ameliorating, and/or preventing lung injury in a subject suffering from or at risk of suffering from acute lung injury (ALI) and/or acute respiratory distress syndrome (ARDS). The disclosure provides A Disintegrin And Metalloproteinase with Thrombospondin type 1 motif, member-13 (ADAMTS13) or a composition comprising ADAMTS13 for treating, ameliorating, and/or preventing the VOC, or for treating, ameliorating, and/or preventing lung injury in a subject suffering from or at risk of suffering from ALI and/or ARDS.