Patents Examined by Sergio Coffa
-
Patent number: 12698312Abstract: The subject of the present invention is a peptide, natural or synthetic, which comprises an amino acid sequence that has at least 80% sequence identity with the sequence SDRSLHLEANEKGENVNVHVTKTRADKSKIKVSVRQYADINEKGEAQYKCPVAQLE (SEQ ID NO: 1). A further object of the present invention is said peptide which has at least 80% sequence identity with the sequence SEQ ID NO: 1 which is a JNK3 inhibitor for use in the prevention and/or treatment of neurodegenerative or neurodevelopmental diseases.Type: GrantFiled: May 14, 2021Date of Patent: August 4, 2026Assignees: UNIVERSITA' DEGLI STUDI DI MILANO, UNIVERSITA' DEGLI STUDI DI ROMA “TOR VERGATA”, UNIVERSITA' POLITECNICA DELLE MARCHEInventors: Tiziana Borsello, Mattia Falconi, Daniele Di Marino
-
Patent number: 12692290Abstract: The invention relates to compounds capable of modulating the permeability of junctions between epithelial cells, and their use to facilitate delivery of substances such as therapeutic and diagnostic agents across epithelial surfaces. In particular the invention relates to the identification of key amino acids in the known permeation enhancer PIP250 and the provision of new permeation enhancing peptides with more transient activity, thus providing faster epithelial recovery.Type: GrantFiled: June 11, 2021Date of Patent: July 28, 2026Assignee: The University of BathInventors: Randy Mrsny, Alistair Taverner, Khaled Almansour
-
Patent number: 12685755Abstract: The present invention provides compositions and formulations comprising glutathione with or without thiocyanate and methods of use thereof to treat diseases and disorders in mucosal/epithelial tissue.Type: GrantFiled: March 25, 2024Date of Patent: July 21, 2026Assignee: The University of North Carolina at Chapel HillInventors: Roland R. Arnold, David C. Henke
-
Patent number: 12686706Abstract: An isolated protein comprising a moiety of 90-200 amino acid residues having at least 70% identity to Bri2 BRICHOS, wherein the amino acid residue corresponding to Arg in position 221 in full-length Bri2 wt is not Arg, Lys or His. The protein is useful as a medicament for use in treatment of Alzheimer's Disease.Type: GrantFiled: January 7, 2021Date of Patent: July 21, 2026Assignee: ALPHABETA ABInventor: Jan Johansson
-
Patent number: 12678541Abstract: Conjugates of fibrinogen and a plurality of curable groups covalently attached thereto, and curable formulations comprising such conjugates, are provided. Also provided are three-dimensional objects (scaffolds) made of the conjugate or the curable formulation, for example, by additive manufacturing, and uses thereof in, for example, tissue healing and/or regeneration.Type: GrantFiled: October 7, 2022Date of Patent: July 14, 2026Assignee: Technion Research & Development Foundation LimitedInventors: Dror Seliktar, Haneen Simaan-Yameen
-
Patent number: 12653866Abstract: The invention is a composition of human insulin or insulin analog that includes specific concentrations of citrate, chloride, in some cases including the addition of sodium chloride, zinc and, optionally, magnesium chloride and/or surfactant, and that has faster pharmacokinetic and/or pharmacodynamic action than commercial formulations of existing insulin analog products.Type: GrantFiled: December 14, 2023Date of Patent: June 16, 2026Assignee: Eli Lilly and CompanyInventors: Michael Patrick Akers, Chi A. Nguyen, Chad D. Paavola, Virender Kumar Sarin, Nanette Elizabeth Schulte, Ranajoy Majumdar
-
Patent number: 12648571Abstract: Disclosed herein are PEG-maximin H5 peptide conjugates and methods for using the same in the treatment or prevention of biofilms and biofouling.Type: GrantFiled: January 26, 2021Date of Patent: June 9, 2026Assignee: University of Puerto RicoInventors: Eduardo Nicolau, Valerie Ortiz Gómez
-
Patent number: 12643935Abstract: The disclosure provides synthetic peptides that selectively bind to the PD-L1 protein on the surface of cells expressing PD-L1. The PD-L1 binding peptide may comprises the amino acid sequence MX1X2X3X4DHX5LNKFX6IX7HXsX9X10X11X12X13 (SEQ ID NO: 177) or MXIF?XXIXXX?WXLXXA (SEQ ID NO: 1). Peptides of the disclosure may be functionalized using one or more diagnostic agents to aid in various detection modalities or with a cytotoxic agent to treat various disease states such as cancer. Also provided are compositions that include the PD-L1 binding peptides or functionalized PD-L1 binding peptides.Type: GrantFiled: April 29, 2021Date of Patent: June 2, 2026Assignees: UNIVERSITY OF SOUTHERN CALIFORNIA, BOARD OF REGENTS, THE UNIVERSITY OF TEXAS SYSTEMInventors: Terry Takahashi, Richard W. Roberts, Golnaz Kamalinia, Justin Ong, Brian Grindel, Brian Engel, Steven Millward
-
Patent number: 12630587Abstract: The invention is concerning a medical preparation comprising bicyclic heptapeptides for use in vertebrates or humans suffering from an infection caused by Gram-negative bacteria like Pseudomonas aeruginosa, Klebsiella pneumoniae, Acineto-bacter baumannii, Neisseria gonorrhoeae, Chlamydia trachomatis, Shigella sonnei, Salmonella enterica Typhimurium LT2, Enterobacter spp., Bifidobacterium longum, Bacteroides fragilis, Lactobacillus reuteri, Enterococcus spp., Yersinia pestis and numerous other Gram-negative bacteria.Type: GrantFiled: November 20, 2020Date of Patent: May 19, 2026Assignee: JUSTUS-LIEBIG-UNIVERSITAET GIESSENInventors: Till Schäberle, Zerlina G. Wuisan, Nils Böhringer, Luis J. Linares-Otoya
-
Patent number: 12624074Abstract: This invention provides polypeptides represented by the following formula: H2N-A-X-B-A-X-B-HOOC which are based on HMGB1 as well as compositions comprising, and treatment methods using, such polypeptide.Type: GrantFiled: May 12, 2022Date of Patent: May 12, 2026Assignee: OXFORD UNIVERSITY INNOVATION LIMITEDInventors: Jagdeep Nanchahal, Alvaro Vinals Guitart, Wyatt Yue, Nicola Burgess-Brown, Tzung Yuan Lee, Ana Isabel Espirito Santo
-
Patent number: 12624072Abstract: Disclosed are compositions and methods for engineered DLL4 proteins. In one aspect, disclosed herein are engineered DLL4 proteins comprising a conservative amino acid substitution at a residue corresponding to residues 28, 107, 143, 194, and 206 as set forth in SEQ ID NO: 1 and further comprising at least one conservative amino acid substitution at residues 256, 257, 271, 280, 301, and 305 as set forth in SEQ ID NO: 1.Type: GrantFiled: May 1, 2020Date of Patent: May 12, 2026Assignee: H. LEE MOFFITT CANCER CENTER AND RESEARCH INSTITUTE, INC.Inventors: Vincent Luca, David Gonzalez Perez
-
Patent number: 12622950Abstract: The present invention relates to method for pretreating a subject with severe von Willebrand disease prior to a surgical procedure comprising administering to the subject a dose ranging from about 20 IU/kg to about 60 IU/kg rVWF between about 12 hours and about 24 hours prior to the surgical procedure, and wherein Factor VIII is not administered with the rVWF prior to the surgical procedure.Type: GrantFiled: December 8, 2021Date of Patent: May 12, 2026Assignee: Takeda Pharmaceutical Company LimitedInventors: Miranda Chapman, Bruce Ewenstein, Bettina Ploder
-
Patent number: 12616740Abstract: The present invention provides a method for increasing glycemic control in a patient in need thereof, by administering tirzepatide, or a pharmaceutically acceptable salt thereof. The present invention provides a method for improving weight management in a patient in need thereof, by administering tirzepatide, or a pharmaceutically acceptable salt thereof. Further providing a method for treating a condition selected from atherosclerosis, chronic kidney disease, NAFLD, and NASH. Further provided is a method to prevent or induce remission of diabetes comprising administration of tirzepatide, or a pharmaceutically acceptable salt thereof. Further provided is a dosing regimen for increasing glycemic control, improving weight management, and/or treating dyslipidemia.Type: GrantFiled: May 23, 2025Date of Patent: May 5, 2026Assignee: ELI LILLY AND COMPANYInventors: Charles T. Benson, Axel Haupt, Melissa Kay Thomas, Shweta Urva
-
Patent number: 12612438Abstract: Bistable type II opsins are provided. Accordingly, there is provided a polypeptide comprising a bistable type II opsin and a heterologous ER export signal and/or membrane trafficking signal. Also provided are polynucleotides encoding same, cells expressing same and methods of use thereof.Type: GrantFiled: September 19, 2021Date of Patent: April 28, 2026Assignee: Yeda Research and Development Co. Ltd.Inventors: Ofer Yizhar, Mathias Mahn
-
Patent number: 12612439Abstract: The present invention relates to a mutant ion channel capable of being activated by light (‘light-activated’ ion channel) and having improved properties, nucleic acids and expression vectors encoding the mutant ion channel, cells comprising such nucleic acid or expression vector, devices containing the mutant ion channel, nucleic acid or expression vector as well as respective uses and methods.Type: GrantFiled: February 3, 2023Date of Patent: April 28, 2026Assignees: GEORG-AUGUST-UNIVERSITÄT GÖTTINGEN STIFTUNG ÖFFENTLICHEN RECHTS, UNIVERSITÄTSMEDIZIN, OPTOGENTECH GMBHInventors: Tobias Moser, Thomas Mager, Maria Zerche
-
Patent number: 12605451Abstract: The present invention is directed to the bifunctional compounds and the use of such bifunctional compounds to lower plasma levels of extracellular target molecules by lysosomal degradation. Such bifunctional compounds have a cell surface receptor ligand covalently linked to a ligand that is capable of binding to an extracellular target molecule (such as a ligand for a growth factor, a cytokine, a chemokine, a hormone, a neurotransmitter, a capsid, a soluble receptor, an extracellular secreted protein, an antibody, a lipoprotein, an exosome, a virus, a cell, or a plasma membrane protein), where the cell surface receptor is associated with receptor mediated endocytosis, including asialoglycoprotein receptor (ASGPR) mediated lysosomal degradation and mannose-6-phosphate (M6PR) mediated lysosomal degradation.Type: GrantFiled: February 4, 2021Date of Patent: April 21, 2026Assignee: NOVARTIS AGInventors: Martin Allan, Jeffrey T. Bagdanoff, David Weninger Barnes, Kevin Clairmont, Thomas Smith, Shuangxi Wang
-
Patent number: 12595283Abstract: Provided is a polypeptide tag. The amino acid sequence of the polypeptide tag is Xaa1Xaa2Xaa3PHDYNXaa4Xaa5Xaa6 (SEQ ID NO: 37), wherein in the formula, Xaa1, Xaa2, Xaa3, Xaa4, Xaa5, and Xaa6 are each independently an amino acid or none. The polypeptide tag is used for labeling a target protein. In a second aspect, provided is a polypeptide fusion protein, comprising the following two structures: (1) any polypeptide tag according to the first aspect, and (2) a target protein connected to the polypeptide tag. Also provided are an in vitro cell-free protein synthesis system and an application thereof in in vitro protein synthesis. By constructing the polypeptide tag and a target protein as a fusion protein, the expression of the labeled target protein can be effectively increased without removing the polypeptide tag.Type: GrantFiled: November 27, 2020Date of Patent: April 7, 2026Assignee: KANGMA-HEALTHCODE (SHANGHAI) BIOTECH CO., LTDInventors: Min Guo, Xue Yu
-
Patent number: 12590119Abstract: Processes and systems related to solid phase peptide synthesis are described. The processes include a flow-through process comprising cyclic addition of amino acids to a column packed with resin, wherein each cycle includes the combination of the amino acids with one or more reagents to provide an activated amino acid mixture, and wherein heating is applied to the amino acid(s) before they are passed through the column and wherein the amino acids are re-circulated at least once over the column packed with resin. Systems for such processes are also described.Type: GrantFiled: March 16, 2021Date of Patent: March 31, 2026Assignee: PEPTISYSTEMS ABInventors: Rannar Sillard, Mats Israelsson, Ulf Tedebark, Lars Holmberg
-
Patent number: 12582924Abstract: A method for obtaining a liquid from a porous solid phase is described. The method comprises forming a liquid seal at a first end of a porous solid phase to which a liquid is bound, wherein liquid of the liquid seal is immiscible with the liquid bound to the solid phase, and applying a pressure differential across the porous solid phase to cause the immiscible liquid to move through the porous solid phase towards a second end of the porous solid phase, thereby displacing the liquid bound to the porous solid phase towards the second end and releasing this liquid from the second end. Recovery of liquid from the solid phase using such methods is increased compared with corresponding methods in which no liquid seal is formed. In preferred embodiments, the liquid used to form the liquid seal is a mineral oil. The methods have particular application in nucleic acid extractions which utilise capture of nucleic acid to a solid phase. Kits and apparatus for performing the methods are also described.Type: GrantFiled: October 20, 2017Date of Patent: March 24, 2026Assignee: Cambridge Enterprise LimitedInventor: Yii Leng Chua
-
Patent number: 12569435Abstract: Methods and pharmaceutical compositions for delivering a therapeutic agent, treating a neovascularization disorder, and treating an ocular infection include make use of a compound that includes an elastin-like polypeptide (ELP) coupled to a therapeutic agent, wherein the ELP comprises at least one repeat of the amino acid sequence VPGXG (SEQ ID NO: 1), and where the composition is suitable for ocular administration.Type: GrantFiled: February 21, 2023Date of Patent: March 10, 2026Assignee: University of Mississippi Medical CenterInventors: Gene L. Bidwell, III, Eric M. George