Abstract: The present invention relates to peptide compound targeting elastin-derived peptides and use thereof. The peptide comprises a parent peptide represented by the following amino acid sequence: R1-Val-Xa2-Gly-Ser-Pro-Ser-Ala-Gln-Xa9-Xa10-Ala-Ser-Pro-Xa14, and is characterized by better biological activity, higher safety and stability, high synthesis yield, low cost, etc. The peptide compound may be used for treating hepatic fibrosis and fibrotic conditions accompanying hepatic disease as well as idiopathic pulmonary fibrosis and fibrotic conditions accompanying pulmonary disease.

Abstract: The invention concerns a plurality of peptides or polypeptides, in, or for use in, an adhesive; ideally said peptides or ploypeptides include at least one, including any combination, of the following sequences: an adhesive sequence, a cross-linking sequence, an elastic conferring sequence, and a de-bonding or cleavable sequence.

Abstract: Described herein are compositions and methods for modulating protein abundance in a target-specific manner via degron tags.

Abstract: The present invention provides a C-terminal CDNF fragment sequence or a sequence which has at least 90% homology to said sequence. The C-terminal CDNF fragment protects ER stressed neurons, motoneurons and dopaminergic neurons and the fragment is capable of penetrating neuronal cell membrane as well as the blood-brain-barrier. The present invention further provides said fragment and pharmaceutical compositions comprising said fragment for use in treatments of degenerative diseases and disorders including central nervous system diseases, diabetes and retinal disorders. The present invention is also providing a C-terminal MANF fragment sequence or a sequence which has at least 90% homology to the said sequence and pharmaceutical compositions comprising said MANF fragment for use in the treatment of degenerative diseases and disorders including central nervous system diseases, diabetes and retinal disorders.

Abstract: The subject of the present invention is a peptide, natural or synthetic, which comprises an amino acid sequence that has at least 80% sequence identity with the sequence SDRSLHLEANEKGENVNVHVTKTRADKSKIKVSVRQYADINEKGEAQYKCPVAQLE (SEQ ID NO: 1). A further object of the present invention is said peptide which has at least 80% sequence identity with the sequence SEQ ID NO: 1 which is a JNK3 inhibitor for use in the prevention and/or treatment of neurodegenerative or neurodevelopmental diseases.

Abstract: The invention relates to compounds capable of modulating the permeability of junctions between epithelial cells, and their use to facilitate delivery of substances such as therapeutic and diagnostic agents across epithelial surfaces. In particular the invention relates to the identification of key amino acids in the known permeation enhancer PIP250 and the provision of new permeation enhancing peptides with more transient activity, thus providing faster epithelial recovery.

Abstract: The present invention provides compositions and formulations comprising glutathione with or without thiocyanate and methods of use thereof to treat diseases and disorders in mucosal/epithelial tissue.

Abstract: An isolated protein comprising a moiety of 90-200 amino acid residues having at least 70% identity to Bri2 BRICHOS, wherein the amino acid residue corresponding to Arg in position 221 in full-length Bri2 wt is not Arg, Lys or His. The protein is useful as a medicament for use in treatment of Alzheimer's Disease.

Abstract: Conjugates of fibrinogen and a plurality of curable groups covalently attached thereto, and curable formulations comprising such conjugates, are provided. Also provided are three-dimensional objects (scaffolds) made of the conjugate or the curable formulation, for example, by additive manufacturing, and uses thereof in, for example, tissue healing and/or regeneration.

Abstract: The invention is a composition of human insulin or insulin analog that includes specific concentrations of citrate, chloride, in some cases including the addition of sodium chloride, zinc and, optionally, magnesium chloride and/or surfactant, and that has faster pharmacokinetic and/or pharmacodynamic action than commercial formulations of existing insulin analog products.

Abstract: Disclosed herein are PEG-maximin H5 peptide conjugates and methods for using the same in the treatment or prevention of biofilms and biofouling.

Abstract: The disclosure provides synthetic peptides that selectively bind to the PD-L1 protein on the surface of cells expressing PD-L1. The PD-L1 binding peptide may comprises the amino acid sequence MX1X2X3X4DHX5LNKFX6IX7HXsX9X10X11X12X13 (SEQ ID NO: 177) or MXIF?XXIXXX?WXLXXA (SEQ ID NO: 1). Peptides of the disclosure may be functionalized using one or more diagnostic agents to aid in various detection modalities or with a cytotoxic agent to treat various disease states such as cancer. Also provided are compositions that include the PD-L1 binding peptides or functionalized PD-L1 binding peptides.

Abstract: The invention is concerning a medical preparation comprising bicyclic heptapeptides for use in vertebrates or humans suffering from an infection caused by Gram-negative bacteria like Pseudomonas aeruginosa, Klebsiella pneumoniae, Acineto-bacter baumannii, Neisseria gonorrhoeae, Chlamydia trachomatis, Shigella sonnei, Salmonella enterica Typhimurium LT2, Enterobacter spp., Bifidobacterium longum, Bacteroides fragilis, Lactobacillus reuteri, Enterococcus spp., Yersinia pestis and numerous other Gram-negative bacteria.

Abstract: This invention provides polypeptides represented by the following formula: H2N-A-X-B-A-X-B-HOOC which are based on HMGB1 as well as compositions comprising, and treatment methods using, such polypeptide.

Abstract: Disclosed are compositions and methods for engineered DLL4 proteins. In one aspect, disclosed herein are engineered DLL4 proteins comprising a conservative amino acid substitution at a residue corresponding to residues 28, 107, 143, 194, and 206 as set forth in SEQ ID NO: 1 and further comprising at least one conservative amino acid substitution at residues 256, 257, 271, 280, 301, and 305 as set forth in SEQ ID NO: 1.

Abstract: The present invention relates to method for pretreating a subject with severe von Willebrand disease prior to a surgical procedure comprising administering to the subject a dose ranging from about 20 IU/kg to about 60 IU/kg rVWF between about 12 hours and about 24 hours prior to the surgical procedure, and wherein Factor VIII is not administered with the rVWF prior to the surgical procedure.

Abstract: The present invention provides a method for increasing glycemic control in a patient in need thereof, by administering tirzepatide, or a pharmaceutically acceptable salt thereof. The present invention provides a method for improving weight management in a patient in need thereof, by administering tirzepatide, or a pharmaceutically acceptable salt thereof. Further providing a method for treating a condition selected from atherosclerosis, chronic kidney disease, NAFLD, and NASH. Further provided is a method to prevent or induce remission of diabetes comprising administration of tirzepatide, or a pharmaceutically acceptable salt thereof. Further provided is a dosing regimen for increasing glycemic control, improving weight management, and/or treating dyslipidemia.

Abstract: Bistable type II opsins are provided. Accordingly, there is provided a polypeptide comprising a bistable type II opsin and a heterologous ER export signal and/or membrane trafficking signal. Also provided are polynucleotides encoding same, cells expressing same and methods of use thereof.

Abstract: The present invention relates to a mutant ion channel capable of being activated by light (‘light-activated’ ion channel) and having improved properties, nucleic acids and expression vectors encoding the mutant ion channel, cells comprising such nucleic acid or expression vector, devices containing the mutant ion channel, nucleic acid or expression vector as well as respective uses and methods.

Abstract: The present invention is directed to the bifunctional compounds and the use of such bifunctional compounds to lower plasma levels of extracellular target molecules by lysosomal degradation. Such bifunctional compounds have a cell surface receptor ligand covalently linked to a ligand that is capable of binding to an extracellular target molecule (such as a ligand for a growth factor, a cytokine, a chemokine, a hormone, a neurotransmitter, a capsid, a soluble receptor, an extracellular secreted protein, an antibody, a lipoprotein, an exosome, a virus, a cell, or a plasma membrane protein), where the cell surface receptor is associated with receptor mediated endocytosis, including asialoglycoprotein receptor (ASGPR) mediated lysosomal degradation and mannose-6-phosphate (M6PR) mediated lysosomal degradation.