Abstract: The present invention further relates to using vaccinia virus complement control protein (VCP), factor H and/or a complement control protein (CCP)-containing protein as modulator of the entry and/or replication of pathogen(s), wherein the pathogen is a virus or bacteria. The present invention further relates to a method of prevention and/or treatment of influenza A virus (IAV) infection in a subject of need thereof and to a method of modulation of the entry and/or replication of pathogen(s) in a subject of need thereof.

Abstract: The present invention relates to novel Mannose-binding lectin (MBL)-associated serine protease (MASP) inhibitory compounds, as well as analogues and derivatives thereof, to processes for the preparation thereof, to the use thereof alone or in combinations for treatment and/or prevention of diseases and to the use thereof for production of medicaments for treatment and/or prevention of diseases, especially for treatment and/or prevention of renal and cardiovascular disorders and of ischemia reperfusion injuries.

Abstract: The invention provides a series of peptides with N-methyl-D-aspartate (NMDA) receptor modulating activity. Specifically it contains two synthetic peptides acting as ion inflow antagonists through the NMDA receptor with specificity GluN2B and GluN2A NMDA receptor subunits and a peptide having agonist activity regarding the NMDA receptor in rat hippocampal neuron cultures.

Abstract: The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.

Abstract: A composition for use in diagnostic and therapeutic applications includes a heteromultivalent nanoparticle or microparticle having an outer surface and a plurality of targeting moieties conjugated to the surface of the nanoparticle or microparticle, the targeting moieties includes a first activated platelet targeting moiety and a second activated platelet targeting moiety.

Abstract: The invention features immunogenic compositions containing anaplastic lymphoma kinase (ALK) polypeptides and methods of use thereof. The immunogenic compositions and methods of the invention may be used to treat a disease associated with ALK in a subject, such as cancer (e.g., a solid tumor cancer or an ALK+ cancer).

Abstract: Compositions containing micropeptides capable of modulating the accumulation of miRs involved in certain pathologies, and the use of these micropeptides for treating the certain pathologies. Also, methods of identifying these micropeptides modulating the accumulation of miRs involved in pathologies. Further, nuclei acids encoding those micropeptides that modulate the accumulation of miRs involved in pathologies.

Abstract: The application is directed to a method of inhibiting or reducing growth of clinical isolate bacteria comprising contacting the clinical isolate with a composition comprising glutathione, a glutathione derivative, a glutathione conjugate, a pharmaceutically-acceptable salt thereof, or any combination thereof.

Abstract: Peptides are provided herein, wherein the peptide bearing one or more amino acid sequence differences relative to SEQ ID NO: 1, with the amino acid sequence differences comprising at least one cysteine replacement.

Abstract: The invention provides formulations comprising a protein in combination with a compound that prevents oxidation of the protein. The invention also provides methods for making such formulations and methods of using such formulations. The invention further provides methods of screening for compounds that prevent oxidation of a protein in a protein composition and methods of preventing oxidation of a protein in a formulation.

Abstract: Disclosed here are polypeptides derived from the HD2 domain of human B-cell CLL/lymphoma 9 (BCL9) protein and variants thereof, as well as their use in the diagnosis, prevention, and/or treatment of a disease or disorder. Also disclosed are methods of generating such polypeptides and variants thereof.

Abstract: The present disclosure relates to solid state forms of Voclosporin processes for preparation thereof, pharmaceutical compositions thereof and uses thereof for treating lupus nephritis.

Abstract: A composition for targeting low-density lipoprotein receptor-related protein 6 (LRP6)-overexpressed cells. The composition includes a peptide including at least one of SEQ ID NO: 1 and SEQ ID NO: 3.

Abstract: The present disclosure is directed to a peptide of formula (I), or a pharmaceutically acceptable salt thereof, and uses thereof: R1—C—R—X1—X2—P—X3—X4—X5—X6—C—R2 (I) wherein X1, X3, X5, and X6 is an amino acid residue selected from the group consisting of serine, alanine, valine, leucine, isoleucine and glycine; X2 is alanine, arginine or lysine; X4 is glutamic acid or aspartic acid; R1 is selected from the group consisting of S, HS, GHS, PGHS, APGHS, EAPGHS, SEAPGHS, SSEAPGHS, PSSEAPGHS, DPSSEAPGHS and IDPSSEAPGHS, or R1 is absent; and R2 is selected from the group consisting of S, SS, SSK, SSKF, SSKFS, SSKFSW, SSKFSWD, SSKFSWDE, SSKFSWDEY, SSKFSWDEYE, SSKFSWDEYEQ, SSKFSWDEYEQY, SSKFSWDEYEQYK, SSKFSWDEYEQYKK, SSKFSWDEYEQYKKE, or R2 is absent; and wherein the peptide of formula (I), or the pharmaceutically acceptable salt thereof, is a cyclic peptide formed by a disulphide bond between the two cysteine residues.

Abstract: Described herein are compositions comprising a BMP-2 derived peptide conjugated to albumin for use in bone grafts. The composition may further include bone matrix, such as demineralized bone matrix (DBM).

Abstract: A method and system is provided for determining a discrimination index in a subject that may be suffering from or at risk for a stress-induced psychiatric disorder. The discrimination index may be equal to a ratio of a subject's cued fear response and non-cued fear response measured during a fear-potentiated startle (FPS) paradigm. Such a value may allow a physician or researcher to quantify how well a subject discriminates between signaled (cued) fear and un-signaled (non-cued) fear, which may be a biomarker for psychiatric disorders like post-traumatic stress disorder, panic disorder, phobias, and/or generalized anxiety disorder. The determined discrimination index may provide a standardized way of diagnosing and evaluating mental illnesses, more uniform treatment of patients, and/or more precise monitoring and evaluation of treatment efficacy.

Abstract: The present disclosure provides the use of a recombinant human secretory DDRGK1. Experiments demonstrate that the recombinant human secretory DDRGK1 prepared by the present disclosure can be used in the preparation of biological medicines for treating intervertebral disc degeneration, fractures or bone defects. The recombinant human secretory DDRGK1 of the present disclosure provides a promising direction for the treatment of bone related diseases and has obtained firm scientific evidence, thereby expanding the further application of recombinant human secretory DDRGK1 in clinical practice.

Abstract: Provided herein is a method for treating an inflammatory bowel disease in a subject in need thereof, the method comprising administering a therapeutically effective amount of a hemoglobin to the subject.

Abstract: The present disclosure provides a genetically encoded calcium indicator (GECI), nucleic acids encoding the GECI, and host cells comprising the GECI. The present disclosure also provides methods of detecting a change in the intracellular concentration of a cell expressing a GECI of the present disclosure.

Abstract: Provided herein are cyclic polypeptide compounds that can, e.g., bind specifically to human proprotein convertase subtilisin/kexin type 9 (PCSK9) and optionally also inhibit interaction between human PCSK9 and human low density lipoprotein receptor (LDLR), and pharmaceutical compositions comprising one or more of these compounds. Also provided are methods of reducing LDL cholesterol level in a subject in need thereof that include administering to the subject one or more of the cyclic polypeptide compounds or a pharmaceutical composition provided herein.