Abstract: The present invention provides a novel molecule that catalyzes a hydrolysis reaction and is different from enzyme proteins. The catalytic peptide according to the present invention is a catalytic peptide that catalyzes a hydrolysis reaction, including at least one peptide selected from the group consisting of the following peptides (A1) to (A4): (A1) a peptide consisting of Box A and at least one of an upstream region and a downstream region therefrom in a Tob/BTG protein; (A2) a peptide consisting of a partial region of the peptide (A1); (A3) a peptide that consists of an amino acid sequence obtained by deletion, substitution, addition, and/or insertion of one or more amino acids in an amino acid sequence of the peptide (A1) or (A2) and has hydrolysis activity; and (A4) a peptide consisting of an amino acid sequence with a sequence identity of at least 85% to the amino acid sequence of the peptide (A1) or (A2) and having hydrolysis activity.

Abstract: Cyclic tetrapeptide stereochemical isomers of CJ-15,208, pharmaceutical compositions from such cyclic tetrapeptides, and methods of using such pharmaceutical compositions. The cyclic tetrapeptide compounds and pharmaceutical compositions disclosed herein are potent analgesics active in several pain models with generally minimal tolerance and reduced likelihood to induce addiction relative to other known opiates.

Abstract: The present disclosure is directed to a universal antivenom for the treatment of venomous animal bites, and methods of developing the same using a novel targeted phage display technique.

Abstract: Described are nanoparticulates comprising a metallic nanoparticle core and a peptide coating or shell encapsulating the nanoparticle core and being covalently bonded thereto. The coating is formed from a plurality of branched, amphipathic peptides, each comprising a polar/positively charged C-terminal segment, a branch point, and two hydrophobic N-terminal segments extending from the branch point. Methods of forming and using the nanoparticulates are also described. When a plurality of first and second peptides are added sequentially to the nanoparticle core, the peptides they self-assemble to form an interlocking peptide network bilayer where the respective hydrophobic segments of the peptides form beta-sheet structures in which the opposed sequences interlock to form a zipper-like structure in three dimensions.

Abstract: Described herein are anti-microbial peptides having enhanced activity and transport.

Abstract: Controlled-release formulations of carboxy-terminal C5a analogs (such as sustained-release formulations of the analogs), and their use in methods for treating and preventing an infection or a disease such as cancer, for directly killing microorganisms, for vaccine preparation, for inducing an immune response and for targeting antigen-presenting cells and other cells bearing a C5a receptor, are provided.

Abstract: The subject invention provides therapeutic compositions, and uses thereof for the treatment or amelioration of injury to small intestine mucosa. In preferred embodiments, the composition comprises one or more nutrients and/or electrolytes that acquire or retain considerable absorptive capacity.

Abstract: A method of alleviating symptoms of, or treating, pancreatic beta-cell damage in a subject includes a step of identifying a subject having pancreatic beta-cell damage. Multiple cycles of a diet protocol are administered to the subject. The diet protocol includes administering of a fasting mimicking diet and a re-feeding diet where the fasting mimicking diet is provided for a first time period and the re-feeding diet is provided for a second time period.

Abstract: The present invention provides a compound or a pharmaceutically acceptable salt of the Formula: X1IVX2SLDVPIGLLQILX3EQEKQEKEKQQAK*TNAX4ILAQV-NH2 wherein the X1 denotes that the I residue is modified by either acetylation or methylation at the N-terminus; wherein X2 is L or T; wherein X3 is L or I; wherein X4 is Q or E; and wherein a modified K residue (“K*”) at position 29 is modified through conjugation to the epsilon-amino group of the K-side chain with a group of the formula —X5—X6, wherein X5 is selected from the group consisting of one to four amino acids; one to four ([2-(2-Amino-ethoxy)-ethoxy]-acetyl) moieties; and combinations of one to four amino acids and one to four ([2-(2-Amino-ethoxy)-ethoxy]-acetyl) moieties; and X6 is a C14-C24 fatty acid. In some embodiments, the group of the formula —X5—X6 is ([2-(2-Amino-ethoxy)-ethoxy]-acetyl)2-(?E)2-CO—(CH2)x—CO2H where x is 16 or 18.

Abstract: The present invention provides method treating a subject suffering from a clinical condition associated with CXCR4 activity, said method comprising administering to a subject in need of such a treatment a therapeutically effective amount of a compound of the formula: or a pharmaceutically acceptable salt thereof, wherein a is 0 or 1; AA1 along with the sulfur atom that is attached thereto is 3-mercaptopropionic acid, optionally substituted cysteine, or optionally substituted homocysteine; AA2 along with the sulfur atom that is attached thereto is cysteine or homocysteine; Ar1 is an optionally substituted aryl; X1 is Arg, Dap, Dab, Orn, Lys, Dap(iPr), Dab(iPr), Orn(iPr), or Lys(iPr); X2 is Arg, Dap, Dab, Orn, Lys, Dap(iPr), Dab(iPr), Orn(iPr), Lys(iPr), a D-isomer thereof, or absent; X3 is Gly or absent; X4 is Phe, 2Nal, 1Nal, or absent; X5 is Gly or absent; R2 is —OR4 or —NHR5; R4 is H or alkyl; and R5 is H, alkyl, optionally substituted aryl, optionally substituted aralkyl.

Abstract: The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis. E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.

Abstract: The present invention is related to novel cytotoxic agents, derivatives of Amanita toxins of Formula (I), wherein , -----, R1, R2, R3, R4, R5, R6, R7, R8, R9, R10, X, L, m, n and Q are defined herein, the preparation and the therapeutic uses in the targeted treatment of cancers, autoimmune disorders, and infectious diseases.

Abstract: The invention relates to the chemistry of peptides, pharmacology and medicine, and specifically to a new group of peptides having the property of stimulating sexual and genital function and having increased storage stability. For this purpose, peptides of general formula (I) are proposed: A-Thr-Lys-Hyp-B-C-D-X, (SEQ ID NO: 8), in which A is 0, Met, Met(0), Thr, Ala, His, Phe, Lys, Gly; B is 0, Gly, Asp, Trp, Gln, Asn, Tyr, Hyp, Arg; C is 0, Arg, Phe, Tyr, Gly, His, Hyp, Lys; D is 0, Val, Gly, Tyr, Trp, Phe, His; X is OH, OCH3, NH2; where 0 is the absence of an amino acid residue, provided that if A?0, then B and/or C and/or D?0, if B?0, then C and/or D?0, excluding the tetrapeptides, as well as the peptides Phe-Thr-Lys-Hyp-Gly, (SEQ ID NO: 9), Thr-Lys-Hyp-Hyp-Arg (SEQ ID NO: 10) and Thr-Lys-Hyp-Arg-Gly (SEQ ID NO: 11).

Abstract: The present disclosure provides aromatic-cationic peptide compositions and methods of using the same. The methods comprise use of the peptides in electron transport, inhibition of cardiolipin peroxidation, and inhibition of apoptosis and necrosis to treat, prevent or ameliorate the symptoms of autoimmune diseases or condition.

Abstract: The present disclosure related in general to methods of treating cancer by interfering with the interaction of metadherin with Staphylococcal nuclease domain-containing 1 (SND1) using peptides or other compounds that inhibit the binding of SND1 with metadherin and inhibit the activity of the MTDH-SND1 complex in tumor cells.

Abstract: The present disclosure provides assays for lysosomal enzymes, specifically palmitoyl protein thioesterase 1 (PPT1) and tripeptidyl peptidase 1 (TPP1), using, for example, tandem mass spectrometry. The assays involve the detection of enzymatic products obtained through the action of the lysosomal enzymes on new enzyme substrates, and can be used for quantitative enzyme activity measurements. The assays for the enzymes utilize a minimum steps for sample work up and can be run in a simplex format or in a duplex format for the detection of neuronal ceroid lipofuscinoses, or in a multiplex format with other mass spectrometry-based assays for screening of neuronal ceroid lipofuscinoses and other lysosomal storage disorders.

Abstract: The invention relates to the treatment of blood, blood products and organs for the removal and/or detoxification of amyloid-beta oligomers.

Abstract: This invention relates to novel compositions comprising analogs of naturally occurring polypeptides, wherein the analog comprises an ?-amino acid and at least one ?-amino acid. Administration of the compositions may be used for effecting treatment or prevention of a plurality of disease states caused by dysfunctional biochemical or biological pathways. The compositions and methods of this invention are particularly useful to identify novel therapeutic modulators of in-vivo receptor activity with extended half-lives and relevant bioactivity as compared to the naturally translated polypeptides upon which the analogs are derived.

Abstract: Contrary to popular belief, diabetes can be reversed through diet and lifestyle changes. The purpose of the present invention is to provide a method to reduce or eliminate the medication intake of a patient with Type 2 Diabetes. This can also lead to the loss of weight and regaining energy levels. The present invention provides a novel and very effective regimen for treatment of Type 2 diabetes not previously available. It is a further object of the present invention to treat Type 2 diabetes with the combination of a specific meal plan, an exercise regimen and specific supplements for cleansing and overcoming bodily deficiencies.

Abstract: Disclosed are methods for conditionally immortalizing stem cells, including adult and embryonic stem cells, the cells produced by such methods, therapeutic and laboratory or research methods of using such cells, and methods to identify compounds related to cell differentiation and development or to treat diseases, using such cells. A mouse model of acute myeloid leukemia (AML) and cells and methods related to such mouse model are also described.