Patents by Inventor Daniel H. Zimmerman

Daniel H. Zimmerman has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20220218806
    Abstract: The invention relates to peptide heteroconjugates useful in treating Rheumatoid Arthritis (RA). The peptide heteroconjugates include a portion of the Human aggrecan protein conjugated to an Immune Cell Binding Ligand (ICBL) by a direct bond or divalent linker. The peptide heteroconjugates including combinations thereof, can be used as a vaccination for RA when combined with an adjuvant and administered to a subject.
    Type: Application
    Filed: May 11, 2019
    Publication date: July 14, 2022
    Applicant: CRL-SCI Corporation
    Inventors: Daniel H. Zimmerman, Tibor T Glant, Katalin MIKECZ, Roy E Carambula
  • Publication number: 20210268101
    Abstract: The invention relates to novel peptide immunoconjugates for treatment, prevention, and diagnosis of coronaviral infections in animals and humans. The immunoconjugates can be used alone or in conjunction with vaccine adjuvants, immune system cells, or other immunomodulators.
    Type: Application
    Filed: January 13, 2021
    Publication date: September 2, 2021
    Applicant: Cel-Sci Corporation
    Inventor: Daniel H. Zimmerman
  • Patent number: 11041013
    Abstract: The invention is related to peptide constructs, i.e.
    Type: Grant
    Filed: March 16, 2009
    Date of Patent: June 22, 2021
    Assignee: Cel-Sci Corporation
    Inventor: Daniel H. Zimmerman
  • Patent number: 10238747
    Abstract: A vaccine for immunization against Type A influenza virus is provided having an immunologically effective amount of peptide constructs obtained by linking together two or more peptides based on or derived from different molecules, and methods for producing the same. The peptide constructs have the formula P1-x-P2 or P2-x-P1 where P1 is associated with Type A influenza highly conserved protein such as but not limited to M2e matrix protein, NP1 nucleoprotein, HA2 core 1, and HA2 core 2, where P2 is a peptide construct causing a Th1 directed immune response by a set or subset of T cells to which the peptide P1 is attached or that binds to a dendritic cell or T cell receptor causing said set or subset of dendritic cell or T cells to which the peptide P1 is attached to initiate and complete, an immune response, and x is a direct bond or divalent linker for covalently bonding P1 and P2.
    Type: Grant
    Filed: December 13, 2011
    Date of Patent: March 26, 2019
    Assignee: Cel-Sci, Corp
    Inventor: Daniel H. Zimmerman
  • Patent number: 10179174
    Abstract: The invention is related to peptide constructs, i.e., polypeptides obtained by linking together two or more peptides based on or derived from different molecules, which are useful in the treatment or prevention of influenza virus and other infectious diseases. Compositions containing the same, methods for producing the same, and methods for using the same are also disclosed, wherein the peptide constructs have the formula P1-x-P2, where P2 is a peptide associated with an infectious agent and P1 is a peptide that will bind to a class of immune cells, such as dendritic cells. The peptide construct can cause the maturation of immature dendritic cells to a more mature state. The peptide construct or the more mature dendritic cell can be administered to a subject to modulate or initiate an immune response against an infectious agent.
    Type: Grant
    Filed: May 24, 2012
    Date of Patent: January 15, 2019
    Assignee: Cel-Sci Corp.
    Inventors: Daniel H. Zimmerman, Eyal Talor, Kanta Subbarao, Kobporn Boonnak
  • Patent number: 10179164
    Abstract: The invention is related to peptide constructs, i.e., polypeptides obtained by linking together two or more peptides based on or derived from different molecules, which are useful in the treatment or prevention of cancer or the treatment of autoimmune diseases and compositions containing same, methods for producing same, and methods for using same; wherein the peptide constructs have the formula P1-x-P2 where P2 is a peptide associated with forms of cancer or an autoimmune condition and P1 is a peptide which will bind to a class of immune cells such as dendritic cells. The peptide construct can cause the maturation of immature dendritic cells to a more mature state. The peptide construct or the more mature dendritic cells can be administered to a subject to a modulate or to initiate an immune response against cancer cells, and can be used with dyes, radioisotopes, or therapeutic agents for detection of the immune target and/or treatment of cancer and autoimmune conditions.
    Type: Grant
    Filed: May 24, 2012
    Date of Patent: January 15, 2019
    Assignee: Cel-Sci Corporation
    Inventors: Daniel H. Zimmerman, Eyal Talor, Kenneth Rosenthal
  • Publication number: 20160158330
    Abstract: The invention is related to peptide constructs, i.e.
    Type: Application
    Filed: April 28, 2014
    Publication date: June 9, 2016
    Applicant: Cel-Sci Corporation
    Inventors: Daniel H. Zimmerman, Roy Carambula, Harold Steiner, Eyal Talor, Tibor Glant, Katalin Mikecz
  • Publication number: 20150140065
    Abstract: The invention is related to peptide constructs, i.e., polypeptides obtained by linking together two or more peptides based on or derived from different molecules, which are useful in the treatment or prevention of influenza virus and other infectious diseases. Compositions containing the same, methods for producing the same, and methods for using the same are also disclosed, wherein the peptide constructs have the formula P1-x-P2, where P2 is a peptide associated with an infectious agent and P1 is a peptide that will bind to a class of immune cells, such as dendritic cells. The peptide construct can cause the maturation of immature dendritic cells to a more mature state. The peptide construct or the more mature dendritic cell can be administered to a subject to modulate or initiate an immune response against an infectious agent.
    Type: Application
    Filed: May 24, 2012
    Publication date: May 21, 2015
    Applicant: CEL-SCI CORPORATION
    Inventors: Daniel H. Zimmerman, Eyal Talor, Kanta Subbarao, Kobporn Boonnak
  • Publication number: 20140286858
    Abstract: The invention is related to peptide constracts, i.e., polypeptides obtained by linking together two or more peptides based on or derived from different molecules, which are useful in the treatment or prevention of cancer or the treatment of autoimmune diseases and compositions containing same, methods for producing same, and methods for using same: wherein the peptide constructs have the formula P1-x-P2 where P2 is a peptide associated with forms of cancer or an autoimmune condition and P1 is a peptide which will bind to a class of immune cells such as dendritic cells. The peptide construct can cause the maturation of immature dendritic cells to a more mature state. The peptide construct or the more mature dendritic cells can be administered to a subject to a modulate or to initiate an immune response against cancer cells, and can be sued with dyes, radioisotopes, or therapeutic agents for detection of the immune target and/or treatment of cancer and autoimmune conditions.
    Type: Application
    Filed: May 24, 2012
    Publication date: September 25, 2014
    Applicant: CEL-SCI CORPORATION
    Inventors: Daniel H. Zimmerman, Eyal Talor, Kenneth Steven Rosenthal
  • Publication number: 20130266599
    Abstract: A vaccine for immunization against Type A influenza virus is provided having an immunologically effective amount of peptide constructs obtained by linking together two or more peptides based on or derived from different molecules, and methods for producing the same. The peptide constructs have the formula P1-x-P2 or P2-x-P1 where P1 is associated with Type A influenza highly conserved protein such as but not limited to M2e matrix protein, NP1 nucleoprotein, HA2 core 1, and HA2 core 2, where P2 is a peptide construct causing a Th1 directed immune response by a set or subset of T cells to which the peptide P1 is attached or that binds to a dendritic cell or T cell receptor causing said set or subset of dendritic cell or T cells to which the peptide P1 is attached to initiate and complete, an immune response, and x is a direct bond or divalent linker for covalently bonding P1 and P2.
    Type: Application
    Filed: December 13, 2011
    Publication date: October 10, 2013
    Applicant: Cel - Sci Corporation
    Inventor: Daniel H. Zimmerman
  • Publication number: 20120039926
    Abstract: The conjugated peptide constructs described herein can be used to induce production of dendritic cells that generate cytokines. The vaccine-bearing dendritic cells can be administered to induce T cell mediated immune modulating responses.
    Type: Application
    Filed: April 14, 2010
    Publication date: February 16, 2012
    Applicants: CEL-SCI CORPORATION, NORTHEASTERN OHIO UNIVERSITIES COLLEGE OF MEDICINE
    Inventors: Kenneth S. Rosenthal, Daniel H. Zimmerman, Patricia R. Taylor
  • Publication number: 20110098444
    Abstract: The invention is related to peptide constructs, i.e.
    Type: Application
    Filed: March 16, 2009
    Publication date: April 28, 2011
    Applicant: CEL-SCI CORPORATION
    Inventor: Daniel H. Zimmerman
  • Patent number: 6995237
    Abstract: Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
    Type: Grant
    Filed: October 27, 2000
    Date of Patent: February 7, 2006
    Assignee: Cel-Sci Corporation
    Inventor: Daniel H. Zimmerman
  • Patent number: 6951647
    Abstract: The present invention is based, in part, on the discovery that a modified version of Peptide G (Asn Gly Gln Glu Glu Lys Ala Gly Val Val Ser Thr Gly Leu Ile—SEQ ID NO:2) obtained by replacing Asn with Asp to form Peptide G? (Asp Gly Gln Glu Glu Lys Ala Gly Val Val Ser Thr Gly Leu Ile—SEQ ID NO: 1) overcomes the long range stabilization problem of the peptide conjugates and, quite surprisingly, also enhances the immune response, particularly the CD4 related (cell mediated) response, of conjugated peptides (L.E.A.P.S. constructs) as previously described.
    Type: Grant
    Filed: May 24, 2001
    Date of Patent: October 4, 2005
    Assignee: Cel-Sci Corporation
    Inventor: Daniel H. Zimmerman
  • Publication number: 20040057968
    Abstract: The present invention is based, in part, on the discovery that a modified version of Peptide G (Asn Gly Gln Glu Glu Lys Ala Gly Val Val Ser Thr Gly Leu Ile—SEQ ID NO:2) obtained by replacing Asn with Asp to form Peptide G′ (Asp Gly Gln Glu Glu Lys Ala Gly Val Val Ser Thr Gly Leu Ile—SEQ ID NO: 1) overcomes the long range stabilization problem of the peptide conjugates and, quite surprisingly, also enhances the immune response, particularly the CD4 related (cell mediated) response, of conjugated peptides (L.E.A.P.S. constructs) as previously described.
    Type: Application
    Filed: November 22, 2002
    Publication date: March 25, 2004
    Inventor: Daniel H. Zimmerman
  • Patent number: 6572860
    Abstract: Peptide constructs chemically synthesized to contain a Herpes Simplex Virus specific antigenic peptide, such as, the 322-332 peptide (H1) from the ICP27 protein of Herpes Simplex Virus (HSV-1) and a peptide from a T cell binding ligand (TCBL), such as &bgr;-2M (aa 35-50), which elicits a TH1-like response in vitro tests in mice, were protective against challenge with HSV.
    Type: Grant
    Filed: March 30, 2000
    Date of Patent: June 3, 2003
    Assignee: CEL-SCI Corporation
    Inventors: Daniel H. Zimmerman, Kenneth S. Rosenthal
  • Patent number: 6287565
    Abstract: A heteroconjugate is formed by linking a T cell binding ligand (TCBL) such as Peptide J of &bgr;-2 microglobulin to a modified HGP-30 antigentic peptide fragment of p17 gag peptide, such as, for example A T L  Y S V  H Q R  I D V  K D T (SEQ ID NO: 5) K E A  L E K  I E E  E Q N  K S The heteroconjugate is effective in eliciting a THI directed immune response and provides a vaccine composition for treating or preventing AIDS.
    Type: Grant
    Filed: June 15, 2000
    Date of Patent: September 11, 2001
    Assignee: Cel-Sci Corporation
    Inventors: Daniel H. Zimmerman, Prem S. Sarin
  • Patent number: 6268472
    Abstract: An antigenic peptide fragment from the p17 gag protein of HIV includes a portion from HGP-30 and a contiguous portion from HGP-35 such that the peptide fragment is capable of inducing a TH1 immune response when administered to a person suffering from AIDS or at risk for AIDS. The peptide has from about 25 to about 37 amino acids, such as, for example, the sequence A T L  Y S V 1 H Q R  I D V  K D T SEQ ID NO.
    Type: Grant
    Filed: June 9, 2000
    Date of Patent: July 31, 2001
    Assignee: CEL Sci Corporation
    Inventors: Daniel H. Zimmerman, Prem S. Sarin
  • Patent number: 6258945
    Abstract: Peptide fragments of the p17 gag protein of HIV-1 from Clade C of from about 30 to about 50 amino acids, including the region extending from position 75 to position 129, raise antibodies recognizing other subtypes, including Clade A, Clade B, Clade E as well as peptides of non-coextensive but overlapping portions of the p17 gag protein. DNA sequences can be used to encode for the peptides of interest.
    Type: Grant
    Filed: June 7, 2000
    Date of Patent: July 10, 2001
    Assignee: Viral Technologies INC
    Inventors: Daniel H. Zimmerman, Prem S. Sarin
  • Patent number: 6111068
    Abstract: Peptide fragments of the p17 gag protein of HIV-1 from Clade C of from about 30 to about 50 amino acids, including the region extending from position 75 to position 129, raise antibodies recognizing other subtypes, including Clade A, Clade B, Clade E as well as peptides of non-coextensive but overlapping portions of the p17 gag protein. DNA sequences can be used to encode for the peptides of interest.
    Type: Grant
    Filed: March 26, 1997
    Date of Patent: August 29, 2000
    Assignee: Viral Technologies, Inc.
    Inventors: Daniel H. Zimmerman, Prem S. Sarin