Abstract: A telecommunications patch panel including a frame member defining a plurality of connector locations, the frame member including front and rear faces, and a first flange extending outwardly from the rear face including at least two tabs. Also included is a cable management member with first and second legs including notch portions and a cable bar coupled to the first and second legs. The notch portions on the cable management member may be engaged within the tabs located on the frame member so as to detachably couple the cable management member to the frame member.

Abstract: A router is configured to provide dynamic policy based in accordance with a plurality of traffic parameters in the packet. The router includes a processor that determines a destination for a packet in accordance with the result of a comparison of a plurality of traffic parameters in the packet with a predetermined traffic profile. The router processor may then forward the packet on a selected one of a plurality of possible routes, in accordance with a dynamic routing protocol.

Abstract: A cable management cabinet assembly for telecommunications equipment. The assembly includes a cabinet frame with sidewalls and vertical support members. A cable management bracket having an elongated member is fastened to the support members. A plurality of fingers project outwardly from the elongated member. The fingers are spaced apart along the length of the elongated member. Gaps sized to receive telecommunications cables are positioned between the fingers. Bend radius limiters are preferably connected to the fingers to prevent cables passing through the gaps from being bent beyond predetermined bend radius requirements. The bracket defines a vertical cable pathway between the side walls and the fingers for guiding cables within the cabinet.

Abstract: A telecommunications electrical connector positions the contacts in a manner to reduce crosstalk problems. An insert assembly positions the spring contacts within a jack for electrical contact with the contacts of a plug. The insert assembly staggers the relative positions of adjacent spring contacts in the y-direction, and staggers the spring contact pivot points in the x-direction, yet maintains a common contact region for all the spring contacts for contacting the contacts of the plug. The distal ends of alternating spring contacts are positioned so as to increase the isolation between adjacent springs. The insert assembly includes selected air passages between spring contacts mounted to the insert assembly to increase isolation and selected dielectric to increase crosstalk cancellation.

Abstract: The present disclosure relates to an insert for a jack. The insert includes a connector mount having a main body including a first side positioned opposite from a second side. The connector mount also includes a snap-fit connection structure positioned at the main body for securing the connector mount to the jack, a divider positioned at the first side of the main body, and an insulation displacement terminal housing positioned at the first side of the main body. A plurality of contact springs are separated by the divider, and a plurality of insulation displacement terminals are housed by the insulation displacement terminal housing. The insert further includes a circuit board that provides electrical connections between the insulation displacement terminals and the contact springs. The circuit board is mounted at the second side of the main body.

Abstract: A telecommunications electrical connector positions the contacts in a manner to reduce crosstalk problems. An insert assembly positions the spring contacts within a jack for electrical contact with the contacts of a plug. The insert assembly staggers the relative positions of adjacent spring contacts in the y-direction, and staggers the spring contact pivot points in the x-direction, yet maintains a common contact region for all the spring contacts for contacting the contacts of the plug. The distal ends of alternating spring contacts are positioned so as to increase the isolation between adjacent springs. The insert assembly includes selected air passages between spring contacts mounted to the insert assembly to increase isolation and selected dielectric to increase crosstalk cancellation.

Abstract: A method and system for matching candidates to available job positions is implemented in a network environment, such as the Internet. A web server is provided to store searchable candidate and job profiles. Candidates can search for available job openings and store their personal profiles in a database maintained by the web server. The personal profiles may be entered through one or more predefined templates having fields related to specific candidate profile information. Employers may conduct searches of the candidate profile database to find one or candidates who match particular job criteria. Matching candidate information may be presented to the employer in response to a search query. Identification data, such as a name, an address or current employer of a particular candidate, may be rendered inaccessible to the employer until a fee is paid.

Abstract: A combination beverage container and spittoon includes a bottom portion including outer wall and a first inner wall defining a spittoon space. A beverage container portion is located radially inwardly from the spittoon space having a top portion having tab means for opening the beverage container portion. During installation, the beverage container top portion includes an outer wall which engages an inner wall of a top member with connecting means. The top member also has an outwardly extending extension hollow extension containing a top opening to receive spit, and a bottom opening which after installation aligns with and is in fluid communication with the spittoon space. Circumferentially spaced from the extension, the beverage container portion includes a lip depression to facilitate drinking from the beverage container. An optional space may be provided between the spittoon space and the beverage container for insulating the beverage.

Abstract: The present disclosure relates to an insert for a jack. The insert includes a connector mount having a main body including a first side positioned opposite from a second side. The connector mount also includes a snap-fit connection structure positioned at the main body for securing the connector mount to the jack, a divider positioned at the first side of the main body, and an insulation displacement terminal housing positioned at the first side of the main body. A plurality of contact springs are separated by the divider, and a plurality of insulation displacement terminals are housed by the insulation displacement terminal housing. The insert further includes a circuit board that provides electrical connections between the insulation displacement terminals and the contact springs. The circuit board is mounted at the second side of the main body.

Abstract: A system for monitoring and reporting the viewing of television programs on a television receiver includes an RF probe which is positioned on the exterior of the receiver housing in close proximity to the intermediate frequency amplifier of the receiver to pick up the intermediate frequency signal therein. A demodulator circuit derives a composite video signal from the intermediate frequency signal. A closed captioning chip and decoder derive channel and/or program information from line 21 of the composite signal, which information is periodically stored in a memory with associated time, date and viewer ID information. The stored viewing information is periodically transmitted by modem to a central monitoring location for analysis. In an alternative embodiment the viewing information is transferred to a removable memory card which is mailed to the central monitoring location.

Abstract: The invention relates to peptides corresponding to regions of the amino acid sequence of TGF-.beta.1 or TGF-.beta.2 which retain, either in monomeric or polymeric forms, at least some of the biological activity of the respective full length TGF-.beta.. The monomeric form of the peptide derived from TGF-.beta.1 comprises the following amino acid sequence: CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGP (SEQ ID NO: 1). The monomeric form of the peptide derived from TGF-.beta.2 comprises the following amino acid sequence: CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGA (SEQ ID NO: 2). Dimers may be formed via disulfide bonds between the amino-terminal cysteine residues, the carboxy-terminal cysteine residues, or amino- and carboxy-terminal cysteine residues of the monomer subunits.

Abstract: A folding machine includes a vacuum conveyor and a plurality of flip folders spaced along the length of the conveyor. A length of sheet material is fed downstream along the conveyor to position the lead end of the sheet in clamp members at a first flip folder. The end is clamped and rotated downstream and up above the remainder of the sheet which is continuously fed down the conveyor. The clamps are released to allow the lead end to fall over the trailing edge of the sheet, thereby completing a first fold which reduces the length of the sheet 50 percent. Successive lead ends of the sheet are folded by second and third flip folders to reduce the length of the sheet to 1/8 the length of the original sheet and increase the thickness of the sheet to eight plies. The final folded bundle is fed to a tuck folder which further reduces the length of the package 50 percent forming a folded package 1/16 the length of the original sheet and having 16 plies.

Abstract: A heterodimeric form of TGF-.beta. is described. This 25 KD molecule is active in an in vitro assay of inhibition of epithelial cell growth. The protein may be isolated from bone. When reduced, the protein elutes in two peaks by RP-HPLC. In immunoblots, the reduced protein from the earlier eluting peak reacts predominately with antibodies directed against TGF-.beta.3, while reduced protein from the later eluting peak reacts predominately with antibodies directed against TGF-.beta.2. The N-terminal amino acid sequence and immunoreactivity of the native protein are consistent with a heterodimer of TGF-.beta.2 and TGF-.beta.3.

Abstract: The invention relates to peptides corresponding to regions of the amino acid sequence of TGF-.beta.1 or TGF-.beta.2 which retain, either in monomeric or polymeric forms, at least some of the biological activity of the respective full length TGF-.beta.. The monomeric form of the peptide derived from TGF-.beta.1 comprises the following amino acid sequence: CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGP (SEQ ID NO: 1). The monomeric form of the peptide derived from TGF-.beta.2 comprises the following amino acid sequence: CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGA (SEQ ID NO: 2). Dimers may be formed via disulfide bonds between the amino-terminal cysteine residues, the carboxy-terminal cysteine residues, or amino- and carboxy-terminal cysteine residues of the monomer subunits.

Abstract: A protective sheath for use with a hypodermic needle comprises a tubular body for accommodating the needle and at least a portion of the syringe barrel adjacent the needle. The sheath is latched in protective relation on the syringe, but may be released by rotation relative to the syringe or by deflection of part of the latch.

Abstract: A protective sheath for use with a hypodermic needle comprises a tubular body for accommodating the needle and at least a portion of the syringe barrel adjacent the needle. The body is latched in protective relation on the syringe, but may be adjusted relative to the latter to enable the needle to be exposed for use.

Abstract: A Hinge Assembly for supporting a storge-type door in a cabinet, the assembly including a cabinet plate in the form of a square having guide grooves along two sides, the grooves intersecting at one corner of the square, a door plate mounted on the cabinet plate for rotary motion between a first position in alignment with one edge of the door plate in alignment with one edge of the first plate to a second position with one edge of the door plate in alignment with the other edge of the cabinet first plate, the door plate having two guide members on the one edge, the guide members being aligned in one of the grooves in the first position and moveable into the other of the grooves on rotation of the door plate with respect to the cabinet plate whereby the door plate rotates within the angle formed between the guide grooves, and a pivot post on one of the plates and a guide member on the other of the plate having a track to define the path of motion for the pivot post on rotation of the door plate with respect to

Abstract: A dock support having a piling composed of an upstanding rod the lower end of which is adapted to be embedded in the bottom of a body of water and an external telescoping sleeve having a cap at its upper end which normally confronts and seats on the upper end of the rod. A passage exists between the confronting surfaces of the inner and outer telescoping members and such passage is occupied by air, rather than water. The air prevents water in the passage rising to the level at which it may freeze, but should water in the passage rise to the freezing level compressed air may be admitted to the passage via a valve under sufficient pressure to purge such water.

Abstract: A drawbar trailer for transporting very long, very heavy, substantially rigid loads, the trailer having a load support platform carried by at least one front and at least one rear axle and separable wheel assembly, the trailer comprising: an adjustable suspension system having inflatable members disposed between the platform and the front and rear axles for selectively raising and lowering the front and rear of the platform and for selectively raising and lowering the sides of the platform; the drawbar being pivotably mounted to the platform about a substantially vertical axis; a mechanism, preferably hydraulic, for turning the wheels of at least one of the front and rear axle and wheel assemblies; an automatic control system for activating the turning mechanism in response to pivotal movements of the drawbar; and, members for securing the load to the platform, whereby the tilt axes of the load support platform can be adjusted with respect to the axle and wheel assemblies, and in turn, with respect to terrain

Abstract: This invention pertains to low-shrink polyester molding resin mixtures primarily based on a certain low-shrink thermoplastic additive produced by synthesizing the vinyl copolymer thermoplastic additive in a hydroxyl terminated polymeric diluent. The resulting vinyl copolymer is dispersed in the hydroxyl containing polymeric diluent which can be post reacted with isocyanate material to produce a polyurethane-vinyl copolymer thermoplastic additive. This thermoplastic additive can be added directly to the thermosetting polyester polymer and monomer mixture to provide a low-shrink molding resin system.