Abstract: A method of determining a risk of developing a neurological disorder in a Long-COVID patient comprising: (a) testing levels of at least one marker associated with a neurologic disorder in a sample taken from the Long-COVID patient, and (b) making a determination that the Long-COVID patient is at risk of developing said neurological disorder when the levels of said at least one marker is increased in the Long-COVID patient compared to healthy control reference levels of said marker. Also a method of determining a risk of developing a cardiometabolic injury in a Long-COVID patient when the levels of expression of a marker associated to a cardiometabolic injury is different in the Long-COVID patient than the levels of said marker in a healthy control. Also methods of treating Long-COVID with a drug effective to mediate the HIF signaling pathway.

Abstract: A method of diagnosing long-COVID-19 in a patient, the method comprising: (a) obtaining a test sample from the patient, (b) performing one or more assays configured to detect a level of one or more biomarkers in the test sample, (c) comparing the level of the one or more proteins in the test sample with a healthy control reference value of said one or more proteins, wherein a change in the level of the one or more biomarkers in the test sample relative to the healthy control reference value of said one or more proteins is indicative of long-COVID-19 diagnosis, wherein the one or more proteins are selected from Table 3.

Abstract: Methods of diagnosing COVID-19 infection in a subject comprising: (a) obtaining a test sample from the subject (b) comparing levels of a biomarker in the test sample with known normal reference levels of the biomarker, wherein an increase in the level f the biomarker in the test sample relative to the known reference levels of the biomarker is indicative of COVID-19 diagnosis in the subject, the biomarker being one or more of granzyme B, tumor necrosis factor (TNF), heat shock protein 70 (HSP70), interleukin-18 (IL-18), interferon-gamma-inducible protein 10 (IP-10) and elastase 2. These biomarkers are used as therapeutic targets for COVID-19 infection. Also, methods that serve to prognosticate the outcome, recovery and disease severity of COVID-19 patients.

Abstract: A method of diagnosing acquired CNS injury (ACNSI) in a subject comprising: (a) obtaining a test sample from the subject (b) comparing levels of a lipid species or a cohort of multiple lipid species in the test sample with the levels of the single lipid species or the cohort of multiple lipid species in a control sample, or comparing to a normal reference range, (i.e. non-ACNSI (referred to as “normal”) subjects) using quantitative measurements, wherein a change (i.e. a drop or an increase) in the level of the lipid species or the cohort of multiple lipid species in the test sample relative to the control sample is indicative of ACNSI in the subject.

Abstract: A safety shutdown system for a vehicle has a device for detecting a panic-level force applied to a vehicle control with a first state indicative of no detected panic-level forces, and a second state indicative of detected panic-level force. This device is coupled to disable a powerplant of the vehicle when in the second state. In particular embodiments the apparatus for detecting has a hydraulic cylinder coupled to a brake line and detects panic-level force on a brake pedal of the vehicle; and in embodiments the apparatus for detecting is adjustable. In other particular embodiments, a second device disables the powerplant of the vehicle upon detecting panic-level force on an accelerator pedal of the vehicle.

Abstract: A method in a computer system in a vessel for generating a presentation of a region-of-interest in an original chart image for display on a display screen, the computer system displaying a representation of the vessel moving along a course in the original chart image, the region-of-interest being located along the course proximate to the representation of the vessel, the method comprising: establishing a lens for the region-of-interest, the lens having a magnified focal region for the region-of-interest at least partially surrounded by a shoulder region having a diminishing magnification, the focal region having a size, a shape, and an orientation with respect to the course; receiving one or more signals to adjust at least one of the size, shape, and orientation of the focal region; and, applying the lens to the original chart image to produce the presentation.

Abstract: A safety shutdown system for a vehicle has a device for detecting a panic-level force applied to a vehicle control with a first state indicative of no detected panic-level forces, and a second state indicative of detected panic-level force. This device is coupled to disable a powerplant of the vehicle when in the second state. In particular embodiments the apparatus for detecting has a hydraulic cylinder coupled to a brake line and detects panic-level force on a brake pedal of the vehicle; and in embodiments the apparatus for detecting is adjustable. In other particular embodiments, a second device disables the powerplant of the vehicle upon detecting panic-level force on an accelerator pedal of the vehicle.

Abstract: A method in a computer system in a vessel for generating a presentation of a region-of-interest in an original chart image for display on a display screen, the computer system displaying a representation of the vessel moving along a course in the original chart image, the region-of-interest being located along the course proximate to the representation of the vessel, the method comprising: establishing a lens for the region-of-interest, the lens having a magnified focal region for the region-of-interest at least partially surrounded by a shoulder region having a diminishing magnification, the focal region having a size, a shape, and an orientation with respect to the course; receiving one or more signals to adjust at least one of the size, shape, and orientation of the focal region; and, applying the lens to the original chart image to produce the presentation.

Abstract: A substantially pure polypeptide (human NESP55) comprising the amino acid sequence (SEQ ID NO: 2) IRLEVPKRMDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALL RALATSNARAQQRAAAQQRRSFLNAHHRSGAQVFPESPESESDHEHEEAD LELSLPECLEYEEEFDYETESETESEIESETDFETEPETAPTTEPETEPE DDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGE ELKPEDKDPRRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPIP IRRH or a variant, fragment, fusion or derivative thereof, or a fusion of a said variant or fragment or derivative, wherein the polypeptide variant has an amino acid sequence which has at least 90% identity with the amino acid sequence given above. NESP55 or fragments thereof may be useful in medicine for the treatment of obesity.