Patents by Inventor Douglas Fraser

Douglas Fraser has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20110076638
    Abstract: The apparatus includes a source of gas (air) bubbles (14) in a liquid medium, the gas bubbles having a size range which is associated with the size of bacteria alone or in colonies, on teeth or other surfaces. A source of ultrasound signals (16, 18) has a range of frequencies between 200 kHz and 2 MHz, the ultrasound frequency range including the resonance frequencies of a majority of the bubbles. The application of the ultrasound to the bubble/liquid stream directed toward the biofilm on the teeth results in a dislodging/removal of the biofilm.
    Type: Application
    Filed: October 1, 2008
    Publication date: March 31, 2011
    Applicant: KONINKLIJKE PHILIPS ELECTRONICS N.V.
    Inventors: Bart Gottenbos, John Douglas Fraser, Jozef Johannes Maria Janssen, Benjamin Marty
  • Publication number: 20110040189
    Abstract: A capacitive ultrasound transducer capable of operation in collapsed mode either with a reduced bias voltage, or with no bias voltage, is provided. The transducer includes a substrate that is contoured so that a middle region of the flexible membrane is collapsed against the substrate in the absence of a bias voltage. A non-collapsible gap may exists between the substrate and peripheral regions of the flexible membrane. The contour of the substrate may be such as to strain the flexible membrane past the point of collapse, or to mechanically interfere with the flexible membrane. The substrate may include a further membrane disposed beneath the flexible membrane, the further membrane being contoured so that the flexible membrane is collapsed against it. The substrate may a support disposed beneath the further membrane to deflect a corresponding portion of the further membrane upward toward the flexible membrane. The support may be a post.
    Type: Application
    Filed: December 12, 2008
    Publication date: February 17, 2011
    Applicant: KONINKLIJKE PHILIPS ELECTRONICS N.V.
    Inventors: John Petruzzello, John Douglas Fraser, Shiwei Zhou, Benoit Dufort, Theodore James Letavic
  • Publication number: 20100275498
    Abstract: Embodiments of the present invention relate to a mounting assembly for mounting a reticle type sight on a long gun. The mounting assembly includes a mounting plate for securing the mounting assembly to a rearward portion of a long gun, and a mounting block coupled to a top portion of the mounting plate. The mounting plate has one or more connection elements to enable a reticle type sight to be coupled to the mounting block.
    Type: Application
    Filed: July 12, 2010
    Publication date: November 4, 2010
    Applicant: Burris Company
    Inventor: Douglas Fraser Paterson
  • Publication number: 20100202254
    Abstract: A capacitive ultrasound transducer includes a first electrode, a second electrode, and a third electrode, the third electrode including a central region disposed in collapsibly spaced relation with the first electrode, and a peripheral region disposed outward of the central region and disposed in collapsibly spaced relation with the second electrode. The transducer further includes a layer of a high dielectric constant material disposed between the third electrode and the first electrode, and between the third electrode and the second electrode. The transducer may be operable in a collapsed mode wherein the peripheral region of the third electrode oscillates relative to the second electrode, and the central region of the third electrode is fully collapsed with respect to the first electrode such that the dielectric layer is sandwiched therebetween. Piezoelectric actuation, such as d31 and d33 mode piezoelectric actuation, may further be included.
    Type: Application
    Filed: July 31, 2008
    Publication date: August 12, 2010
    Applicant: KONINKLIJKE PHILIPS ELECTRONICS N.V.
    Inventors: Aarnoud Laurens Roest, Klaus Reimann, Mareike Klee, Jozef Thomas Martinus Van Beek, John Douglas Fraser
  • Publication number: 20090267743
    Abstract: In one embodiment, an apparatus includes a first assembly, a second assembly, and a coupling element coupled to the first assembly and the second assembly. The first assembly includes a processor, a memory, and a radiator module, the processor operatively coupled to the memory and the radiator module. The second assembly includes a radiator operatively coupled to the radiator module. The second assembly is movable relative to the first assembly about the coupling element between a first configuration and a second configuration. The processor is configured to interrogate a radio-frequency identification module via the radiator module and the radiator when the second assembly is in the second configuration.
    Type: Application
    Filed: April 29, 2009
    Publication date: October 29, 2009
    Inventors: Kiely Per Faroe, Christoper Lee Fennig, Gordon Douglas Fraser, Patrick J. Sweeney, II, David Vetter
  • Publication number: 20090113778
    Abstract: Embodiments of the present invention relate to a mounting assembly for mounting a reticle type sight on a long gun. The mounting assembly includes a mounting plate for securing the mounting assembly to a rearward portion of a long gun, and a mounting block coupled to a top portion of the mounting plate. The mounting plate has one or more connection elements to enable a reticle type sight to be coupled to the mounting block.
    Type: Application
    Filed: November 2, 2007
    Publication date: May 7, 2009
    Applicant: Burris Company
    Inventor: Douglas Fraser Paterson
  • Patent number: 7092853
    Abstract: A continuous environmental noise level recording and analysis system is provided. The system is capable of sampling, processing and storing Equivalent Sound Level values over a period of about two weeks. The recorded data is downloaded and analyzed to show graphs, and to automatically detect noise events of interest.
    Type: Grant
    Filed: October 25, 2002
    Date of Patent: August 15, 2006
    Assignee: The Trustees of Dartmouth College
    Inventors: Robert D. Collier, Douglas A. Fraser, Kenneth Kaliski, G. Ayorkor Mills-Tettey, Efrosyni Seitaridou
  • Publication number: 20050285861
    Abstract: A method in a computer system in a vessel for generating a presentation of a region-of-interest in an original chart image for display on a display screen, the computer system displaying a representation of the vessel moving along a course in the original chart image, the region-of-interest being located along the course proximate to the representation of the vessel, the method comprising: establishing a lens for the region-of-interest, the lens having a magnified focal region for the region-of-interest at least partially surrounded by a shoulder region having a diminishing magnification, the focal region having a size, a shape, and an orientation with respect to the course; receiving one or more signals to adjust at least one of the size, shape, and orientation of the focal region; and, applying the lens to the original chart image to produce the presentation.
    Type: Application
    Filed: June 23, 2005
    Publication date: December 29, 2005
    Applicant: Idelix Software, Inc.
    Inventor: Douglas Fraser
  • Publication number: 20030204381
    Abstract: A continuous environmental noise level recording and analysis system is provided. The system is capable of sampling, processing and storing Equivalent Sound Level values over a period of about two weeks. The recorded data is downloaded and analyzed to show graphs, and to automatically detect noise events of interest.
    Type: Application
    Filed: October 25, 2002
    Publication date: October 30, 2003
    Inventors: Robert D. Collier, Douglas A. Fraser, Kenneth Kaliski, G. Ayorkor Mills-Tettey, Efrosyni Seitaridou
  • Patent number: 6632178
    Abstract: An ultrasonic transducer is formed by a plurality of cMUT cells, each comprising a charged diaphragm plate capacitively opposing an oppositely charged base plate. The cMUT cells can be fabricated by conventional semiconductor processes and hence integrated with ancillary transducer circuitry such as a bias charge regulator. The cMUT cells can also be fabricated by micro-stereolithography whereby the cells can be formed using a variety of polymers and other materials.
    Type: Grant
    Filed: October 27, 2000
    Date of Patent: October 14, 2003
    Assignee: Koninklijke Philips Electronics N.V.
    Inventor: John Douglas Fraser
  • Patent number: 6608025
    Abstract: A substantially pure polypeptide (human NESP55) comprising the amino acid sequence (SEQ ID NO: 2) IRLEVPKRMDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALL RALATSNARAQQRAAAQQRRSFLNAHHRSGAQVFPESPESESDHEHEEAD LELSLPECLEYEEEFDYETESETESEIESETDFETEPETAPTTEPETEPE DDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGE ELKPEDKDPRRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPIP IRRH or a variant, fragment, fusion or derivative thereof, or a fusion of a said variant or fragment or derivative, wherein the polypeptide variant has an amino acid sequence which has at least 90% identity with the amino acid sequence given above. NESP55 or fragments thereof may be useful in medicine for the treatment of obesity.
    Type: Grant
    Filed: December 21, 1999
    Date of Patent: August 19, 2003
    Assignee: Knoll, AG
    Inventors: Douglas Fraser, Steven St. Gallay
  • Patent number: 6469422
    Abstract: A two dimensional ultrasonic transducer array suitable for three dimensional phased array scanning is formed of hexagonally close packed transducer elements. In a preferred embodiment the transducer elements have a rectilinear shape, allowing the array to be fabricated with conventional dicing saw processes.
    Type: Grant
    Filed: January 30, 2002
    Date of Patent: October 22, 2002
    Assignee: Koninklijke Philips Ultrasound N.V.
    Inventor: John Douglas Fraser
  • Publication number: 20020130591
    Abstract: A two dimensional ultrasonic transducer array suitable for three dimensional phased array scanning is formed of hexagonally close packed transducer elements. In a preferred embodiment the transducer elements have a rectilinear shape, allowing the array to be fabricated with conventional dicing saw processes.
    Type: Application
    Filed: January 30, 2002
    Publication date: September 19, 2002
    Inventor: John Douglas Fraser
  • Patent number: 6443901
    Abstract: An ultrasonic transducer is formed by a plurality of cMUT cells, each comprising a charged diaphragm plate capacitively opposing an oppositely charged base plate. The diaphragm plate is distended toward the base plate by a bias charge. The base plate includes a central portion elevated toward the center of the diaphragm plate to cause the charge of the cell to be of maximum density at the moving center of the diaphragm plate. For harmonic operation the drive pulses applied to the cells are predistorted in consideration of the nonlinear operation of the device to reduce contamination of the transmit signal at the harmonic band. The cMUT cells can be fabricated by conventional semiconductor processes and hence integrated with ancillary transducer circuitry such as a bias charge regulator. The cMUT cells can also be fabricated by micro-stereolithography whereby the cells can be formed using a variety of polymers and other materials.
    Type: Grant
    Filed: June 15, 2000
    Date of Patent: September 3, 2002
    Assignee: Koninklijke Philips Electronics N.V.
    Inventor: John Douglas Fraser
  • Patent number: 6432966
    Abstract: The present invention relates to therapeutic combinations comprising (2R,cis)-4-amino-1-(2-hydroxymethyl-1,3-oxathiolan-5-yl)-pyrimidin-2-one (lamivudine) and BMS-200475 which have anti-hepatitis B virus (HBV) activity. The present invention is also concerned with pharmaceutical compositions containing said combinations and their use in the treatment of HBV infections including infections with HBV mutants bearing resistance to nucleoside and/or non-nucleoside inhibitors.
    Type: Grant
    Filed: October 29, 1999
    Date of Patent: August 13, 2002
    Assignee: SmithKline Beecham Corporation
    Inventors: Marc Rubin, Nathaniel A. Brown, Lynn D. Condreay, Douglas Fraser Gray
  • Patent number: 6384516
    Abstract: A two dimensional ultrasonic transducer array suitable for three dimensional phased array scanning is formed of hexagonally close packed transducer elements. In a preferred embodiment the transducer elements have a rectilinear shape, allowing the array to be fabricated with conventional dicing saw processes.
    Type: Grant
    Filed: January 21, 2000
    Date of Patent: May 7, 2002
    Assignee: ATL Ultrasound, Inc.
    Inventor: John Douglas Fraser
  • Publication number: 20020002180
    Abstract: The present invention relates to therapeutic combinations comprising (2R,cis)-4-amino-1-(2-hydroxymethyl-1,3-oxathiolan-5-yl)-pyrimidin-2-one (lamivudine) and BMS-200475 which have anti-hepatitis B virus (HBV) activity. The present invention is also concerned with pharmaceutical compositions containing said combinations and their use in the treatment of HBV infections including infections with HBV mutants bearing resistance to nucleoside and/or non-nucleoside inhibitors.
    Type: Application
    Filed: October 29, 1999
    Publication date: January 3, 2002
    Inventors: MARC RUBIN, NATHANIEL A BROWN, LYNN D CONDREAY, DOUGLAS FRASER GRAY
  • Patent number: 6328696
    Abstract: An ultrasonic transducer is formed by a plurality of cMUT cells, each comprising a charged diaphragm plate capacitively opposing an oppositely charged base plate. A feedback controlled bias charge regulator controls the bias charge of the capacitive plates. The cMUT cells can be fabricated by conventional semiconductor processes and hence integrated with ancillary transducer circuitry such as the bias charge regulator.
    Type: Grant
    Filed: October 27, 2000
    Date of Patent: December 11, 2001
    Assignee: ATL Ultrasound, Inc.
    Inventor: John Douglas Fraser
  • Patent number: 6328697
    Abstract: An ultrasonic transducer is formed by a plurality of cMUT cells, each has a charged diaphragm plate capacitively opposing an oppositely charged base plate. The diaphragm plate is distended toward the base plate by a bias charge. The base plate includes a central portion elevated toward the center of the diaphragm plate to cause the charge of the cell to be of maximum density at the moving center of the diaphragm plate.
    Type: Grant
    Filed: October 27, 2000
    Date of Patent: December 11, 2001
    Assignee: ATL Ultrasound, Inc.
    Inventor: John Douglas Fraser
  • Patent number: D587471
    Type: Grant
    Filed: February 21, 2008
    Date of Patent: March 3, 2009
    Inventor: Keith Douglas Fraser