Patents by Inventor Hiroshi Nakayama

Hiroshi Nakayama has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 10097666
    Abstract: An information processing method includes receiving a request for user data that is related to an external service, and retrieving the user data segments based on the request. The user data segments are then combined to generate the user data, which is then provided to the client device that requested the user data. After receiving the user data, the client device uses the user data to access the external service to which the data relates.
    Type: Grant
    Filed: April 11, 2013
    Date of Patent: October 9, 2018
    Assignee: SONY CORPORATION
    Inventors: Takeru Kaneko, Hiroshi Nakayama, Toshiaki Enami, Kohei Umemoto
  • Patent number: 10046328
    Abstract: Provided is a jaw crusher driving device in which a driving torque can be transmitted reliably to a rotation driving shaft to perform a crushing operation by strongly fixing a hydraulic pressure motor between a body frame of a jaw crusher and a flywheel. The jaw crusher includes a fixed tooth, a movable tooth, a rotation driving shaft rotatably supported on a body frame, and a pair of flywheels provided in the rotation driving shaft. The driving device includes: a hydraulic pressure motor in which a rotation shaft portion can rotate in relation to a motor body when pressure fluid is supplied; a connector for connecting one flywheel of the pair of flywheels and the rotation shaft portion; and a torque arm provided between the body frame and the motor body so as to prevent the motor body from rotating about an axis of the rotation driving shaft.
    Type: Grant
    Filed: February 24, 2015
    Date of Patent: August 14, 2018
    Assignee: NAKAYAMA IRON WORKS, LTD.
    Inventors: Hiroshi Nakayama, Hideki Tominaga
  • Publication number: 20180205918
    Abstract: There is provided an image processing apparatus, an image processing method, and a program which can cause an image adapted to an object located between an operation unit and a drawing destination (30) to be drawn on the drawing destination, the image processing apparatus including: an image generating unit configured to generate a drawn image to be drawn on a drawing destination on a basis of a position of an operation unit. The image generating unit generates the drawn image on a basis of detected information of a stencil target (40) located between the operation unit and the drawing destination.
    Type: Application
    Filed: July 14, 2016
    Publication date: July 19, 2018
    Applicant: SONY CORPORATION
    Inventors: Satoshi ASAI, Hiroshi NAKAYAMA, Hiromi IIZUKA, Takumi SUZUKI, Tomoya NARITA
  • Patent number: 9896500
    Abstract: The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus. Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.
    Type: Grant
    Filed: December 22, 2016
    Date of Patent: February 20, 2018
    Assignee: Panasonic Intellectual Property Management Co., Ltd.
    Inventors: Keiko Yugawa, Jin Muraoka, Junko Muraoka, Hiroshi Nakayama
  • Publication number: 20170330192
    Abstract: An electronic money system terminates communication to a management center indistinguishably from a case in which the communication to the management center is completed within a predetermined period when it is impossible to complete the communication to the management center within the predetermined period. By switching an operation mode, a predetermined portable terminal is used instead of a communication line to upload and download data. When it is impossible to obtain data required for processing through the communication line, processing is performed based on data possessed up until that time.
    Type: Application
    Filed: August 1, 2017
    Publication date: November 16, 2017
    Inventors: Yasuo Takeshima, Fumio Kubono, Hiroshi Abe, Kazuo Omori, Fumio Tsuyama, Hiroshi Nakayama
  • Patent number: 9787646
    Abstract: An electronic money system terminates communication to a management center indistinguishably from a case in which the communication to the management center is completed within a predetermined period when it is impossible to complete the communication to the management center within the predetermined period. By switching an operation mode, a predetermined portable terminal is used instead of a communication line to upload and download data. When it is impossible to obtain data required for processing through the communication line, processing is performed based on data possessed up until that time.
    Type: Grant
    Filed: January 17, 2008
    Date of Patent: October 10, 2017
    Assignee: Sony Corporation
    Inventors: Yasuo Takeshima, Fumio Kubono, Hiroshi Abe, Kazuo Omori, Fumio Tsuyama, Hiroshi Nakayama
  • Publication number: 20170283485
    Abstract: The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus. Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.
    Type: Application
    Filed: December 22, 2016
    Publication date: October 5, 2017
    Inventors: KEIKO YUGAWA, JIN MURAOKA, JUNKO MURAOKA, HIROSHI NAKAYAMA
  • Publication number: 20170270308
    Abstract: A secure area includes a processor that is included in a secure area and a first memory with storage capacity less than a predetermined amount. The processor decrypts, when encrypted first information and encrypted second information are input from a secret input path, the first information and the second information and stores the first information in the first memory. The processor encrypts, by using an encryption key obtained based on the decrypted first information, the decrypted second information and makes a request to store the encrypted second information in a second memory that is present outside the secure area.
    Type: Application
    Filed: June 1, 2017
    Publication date: September 21, 2017
    Applicant: FUJITSU LIMITED
    Inventors: HIROSHI NAKAYAMA, Kiyoshi Kohiyama
  • Publication number: 20170249124
    Abstract: A pointing support apparatus includes a memory, and a processor coupled to the memory and configured to detect a line-of-sight position of a user on a screen, extract a command included in a search range of the screen with reference to the line-of-sight position, generate a table in which the command and speech information of the command are associated with each other, and decide, when speech information from outside is accepted, a command based on comparison of the recognized speech information and the speech information of the table.
    Type: Application
    Filed: February 16, 2017
    Publication date: August 31, 2017
    Applicant: FUJITSU LIMITED
    Inventors: HIROSHI NAKAYAMA, Junichi Odagiri, Satoshi Nakashima, Kentaro Murase, Masakiyo Tanaka
  • Patent number: 9685458
    Abstract: A display device includes a display region comprising a plurality of pixels, each pixel of the plurality of pixels comprises a light emitting element which includes a pixel electrode, a conductive layer below the pixel electrode and configured to receive a specified electric voltage, and a thin film transistor below the pixel electrode and the conductive layer, wherein the thin film transistor comprises a semiconductor layer which includes a channel region, a gate electrode which is overlapping the channel region, a first electrode electrically connected to the semiconductor layer and the pixel electrode, and a second electrode electrically connectable to a power supply line, wherein the conductive layer includes an overlapped region which overlaps with the channel region, and the first electrode extends so as to cover the gate electrode at the overlapped region.
    Type: Grant
    Filed: October 13, 2015
    Date of Patent: June 20, 2017
    Assignee: Japan Display Inc.
    Inventors: Hiroshi Tabatake, Hiroyuki Kimura, Makoto Shibusawa, Hiroshi Nakayama, Tetsuo Morita, Yutaka Umeda
  • Publication number: 20170139477
    Abstract: A pointing support device detects user's gaze position on a screen, sets the gaze position as an initial position of a pointer, displays a path starting from the initial position on the screen on the basis of path definition information, which defines the path to move the pointer and a movement pattern of the path and moves the pointer along the path.
    Type: Application
    Filed: October 24, 2016
    Publication date: May 18, 2017
    Applicant: FUJITSU LIMITED
    Inventors: HIROSHI NAKAYAMA, JUNICHI ODAGIRI, Satoshi NAKASHIMA, Kentaro Murase, Masakiyo TANAKA
  • Patent number: 9652598
    Abstract: There is provided an information processing device including a communication unit configured to receive editing information of content data, an accumulation unit configured to accumulate the editing information, and a control unit configured to control whether to return the editing information to an external device in accordance with a right to use content corresponding to a requestor's identification information included in request information for requesting the editing information, the request information being received from the external device via the communication unit.
    Type: Grant
    Filed: February 18, 2015
    Date of Patent: May 16, 2017
    Assignee: SONY CORPORATION
    Inventors: Sumio Okada, Hiroshi Nakayama, Ryota Sakamoto, Chika Miura, Tsutomu Kawachi, Masayuki Chatani, Eiji Miyakawa
  • Patent number: 9626217
    Abstract: There is provided an information processing apparatus including a receiver configured to receive a request to perform processing related to a task, from a first information processing apparatus which functions as a client on a network; a scheduler configured to, when a rank of a priority of the scheduler of the information processing apparatus among information processing apparatuses on the network is a first predetermined rank or higher, assign the task to one or a plurality of second information processing apparatuses which function as nodes on the network; and a transmitter configured to transmit a request to execute processing related to the task assigned to the one or the plurality of second information processing apparatuses.
    Type: Grant
    Filed: January 22, 2015
    Date of Patent: April 18, 2017
    Assignee: Sony Corporation
    Inventors: Shuhei Sonoda, Masayuki Takada, Eiji Miyakawa, Hiroshi Nakayama, Tsutomu Kawachi
  • Patent number: 9542890
    Abstract: According to one embodiment, a display device includes a plurality of pixel units which each includes a light-emitting element and a pixel circuit, a plurality of first scan lines and second scan lines, a plurality of video signal lines, a controller which controls a scan line drive circuit and a signal line drive circuit, wherein the pixel circuit comprises an output switch, a drive transistor, a capacitance, and a pixel switch, wherein the controller controls a reset operation, a cancellation operation, a correction operation, and a light-emitting operation, and the controller deforms a waveform of a control signal which is supplied from the second scan line in a manner that a time of transitioning the pixel switch from an on-state to an off-state is longer than the time of transitioning by a non-deformed control signal, when writing the video voltage signal in the correction operation.
    Type: Grant
    Filed: November 26, 2014
    Date of Patent: January 10, 2017
    Assignee: Japan Display Inc.
    Inventors: Hiroshi Nakayama, Tetsuo Morita, Hiroyuki Kimura, Makoto Shibusawa
  • Publication number: 20160217736
    Abstract: A display device with a plurality of pixels including a video signal wire, a first power supply wire connecting via a first switch a first power supply outputting a first voltage and connecting via a second switch a second power supply outputting a second voltage different to the first voltage, a second power supply wire connecting a third power supply outputting a third voltage different to the first voltage and the second voltage, a light emitting element arranged between the first power supply wire and the second power supply wire, a drive transistor controlling a value of a current supplied to the light emitting element, and a third switch arranged between the video signal wire and the drive transistor, the first power supply wire becoming the second voltage in a first time period within 1 horizontal scanning period, and becoming the first voltage in a remaining second time period.
    Type: Application
    Filed: January 20, 2016
    Publication date: July 28, 2016
    Inventors: Hiroshi NAKAYAMA, Duzen PENG, Ilin WU, Makoto SHIBUSAWA
  • Patent number: 9360241
    Abstract: A heat pump system includes a heat pump circuit, a load distribution element, and a controller. The heat pump circuit includes low-stage and high-stage compression mechanisms having a fixed capacity ratio relationship. The load distribution element establishes a load distribution between first and second heat loads subjected to heating processes by heat exchange with refrigerant discharged from the low-stage and high-stage compression mechanisms, respectively. The controller performs distribution control to maintain a ratio of 1 between temperatures of the refrigerant discharged from the low-stage and high stage compression mechanisms and after heat exchange with the first and second heat loads, respectively. Alternatively, the controller performs distribution control to reduce a difference between the temperatures of the refrigerant discharged from the low-stage and high stage compression mechanisms and after heat exchange with the first and second heat loads, respectively.
    Type: Grant
    Filed: July 13, 2011
    Date of Patent: June 7, 2016
    Assignee: Daikin Industries, Ltd.
    Inventors: Hiroshi Nakayama, Shuji Fujimoto
  • Publication number: 20160146479
    Abstract: First and second adsorption heat exchangers are provided for first and second heat exchange chambers, respectively, and each interchangeably function as an evaporator or a condenser. If the first adsorption heat exchanger functions as an evaporator in the first heat exchange chamber, a first adsorption block is arranged at a position downstream of the first adsorption heat exchanger. If the second adsorption heat exchanger functions as an evaporator in the second heat exchange chamber, a second adsorption block is arranged at a position downstream of the second adsorption heat exchanger.
    Type: Application
    Filed: June 24, 2014
    Publication date: May 26, 2016
    Applicants: DAIKIN INDUSTRIES, LTD., DAIKIN APPLIED SYSTEMS CO., LTD.
    Inventors: Naotoshi FUJITA, Toshiyuki NATSUME, Hiroshi NAKAYAMA, Nobuki MATSUI
  • Publication number: 20160104761
    Abstract: A display device includes a display region comprising a plurality of pixels, each pixel of the plurality of pixels comprises a light emitting element which includes a pixel electrode, a conductive layer below the pixel electrode and configured to receive a specified electric voltage, and a thin film transistor below the pixel electrode and the conductive layer, wherein the thin film transistor comprises a semiconductor layer which includes a channel region, a gate electrode which is overlapping the channel region, a first electrode electrically connected to the semiconductor layer and the pixel electrode, and a second electrode electrically connectable to a power supply line, wherein the conductive layer includes an overlapped region which overlaps with the channel region, and the first electrode extends so as to cover the gate electrode at the overlapped region.
    Type: Application
    Filed: October 13, 2015
    Publication date: April 14, 2016
    Inventors: Hiroshi TABATAKE, Hiroyuki KIMURA, Makoto SHIBUSAWA, Hiroshi NAKAYAMA, Tetsuo MORITA, Yutaka UMEDA
  • Patent number: 9297543
    Abstract: A dehumidification system for a dry clean room includes: a dry chamber supplied with air having a lower humidity than air in the dry clean room; a main dehumidification unit which supplies air to the dry clean room; and a terminal dehumidification unit which processes the air to be supplied from the dry clean room to the dry chamber, thus achieving energy saving and cost reduction for the dehumidification system for the dry clean room.
    Type: Grant
    Filed: December 11, 2013
    Date of Patent: March 29, 2016
    Assignees: DAIKIN INDUSTRIES, LTD., DAIKIN APPLIED SYSTEMS CO., LTD.
    Inventors: Hiroshi Nakayama, Toshiyuki Natsume, Naotoshi Fujita, Eisaku Okubo, Nobuki Matsui
  • Patent number: D817353
    Type: Grant
    Filed: March 7, 2014
    Date of Patent: May 8, 2018
    Assignee: SONY CORPORATION
    Inventors: Nobuhiro Jogano, Tetsuro Tsuji, Hiroshi Nakayama