Abstract: There is provided an image processing apparatus, an image processing method, and a program which can cause an image adapted to an object located between an operation unit and a drawing destination (30) to be drawn on the drawing destination, the image processing apparatus including: an image generating unit configured to generate a drawn image to be drawn on a drawing destination on a basis of a position of an operation unit. The image generating unit generates the drawn image on a basis of detected information of a stencil target (40) located between the operation unit and the drawing destination.

Abstract: A pointing support device detects user's gaze position on a screen, sets the gaze position as an initial position of a pointer, displays a path starting from the initial position on the screen on the basis of path definition information, which defines the path to move the pointer and a movement pattern of the path and moves the pointer along the path.

Abstract: A pointing support apparatus includes a memory, and a processor coupled to the memory and configured to detect a line-of-sight position of a user on a screen, extract a command included in a search range of the screen with reference to the line-of-sight position, generate a table in which the command and speech information of the command are associated with each other, and decide, when speech information from outside is accepted, a command based on comparison of the recognized speech information and the speech information of the table.

Abstract: [Object] To realize a system that can more accurately analyze a movement of a body with a simpler configuration. [Solution] An information processing device includes: a first member that includes a substantially plate-shaped casing and a predetermined detection unit; a second member that includes a substantially plate-shaped casing and that holds a battery inside the second member; and a connection unit that includes an elastic body and connects a part of an outer circumferential end surface of the first member to a part of an outer circumferential end surface of the second member such that a surface direction of one surface of the first member substantially matches a surface direction of one surface of the second member. The information processing device is worn on a predetermined body part such that the one surface of the first member and the one surface of the second member are located on a side of the body part.

Abstract: A flash phenomenon of OLEDs at the time of power source ON of a display device is suppressed. The OLED emits light when reference potentials VSS and VDD are applied from power source lines to the OLED's cathode and anode respectively. While the anode can be connected to one of the power source line via a driving TFT and a lighting switch, a reset potential VRS can be applied to the anode via a reset switch and the driving TFT. The lighting switch is turned OFF and the reset switch and the driving TFT are turned ON so that VRS is applied to the anode, before starting the application of the reference potentials to the power source lines. Following this state, the application of the reference potentials to the power source lines starts, and thus a normal operation of allowing the OLED to emit light starts.

Abstract: An information processing method includes receiving a request for user data that is related to an external service, and retrieving the user data segments based on the request. The user data segments are then combined to generate the user data, which is then provided to the client device that requested the user data. After receiving the user data, the client device uses the user data to access the external service to which the data relates.

Abstract: Provided is a jaw crusher driving device in which a driving torque can be transmitted reliably to a rotation driving shaft to perform a crushing operation by strongly fixing a hydraulic pressure motor between a body frame of a jaw crusher and a flywheel. The jaw crusher includes a fixed tooth, a movable tooth, a rotation driving shaft rotatably supported on a body frame, and a pair of flywheels provided in the rotation driving shaft. The driving device includes: a hydraulic pressure motor in which a rotation shaft portion can rotate in relation to a motor body when pressure fluid is supplied; a connector for connecting one flywheel of the pair of flywheels and the rotation shaft portion; and a torque arm provided between the body frame and the motor body so as to prevent the motor body from rotating about an axis of the rotation driving shaft.

Abstract: There is provided an image processing apparatus, an image processing method, and a program which can cause an image adapted to an object located between an operation unit and a drawing destination (30) to be drawn on the drawing destination, the image processing apparatus including: an image generating unit configured to generate a drawn image to be drawn on a drawing destination on a basis of a position of an operation unit. The image generating unit generates the drawn image on a basis of detected information of a stencil target (40) located between the operation unit and the drawing destination.

Abstract: The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus. Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.

Abstract: An electronic money system terminates communication to a management center indistinguishably from a case in which the communication to the management center is completed within a predetermined period when it is impossible to complete the communication to the management center within the predetermined period. By switching an operation mode, a predetermined portable terminal is used instead of a communication line to upload and download data. When it is impossible to obtain data required for processing through the communication line, processing is performed based on data possessed up until that time.

Abstract: An electronic money system terminates communication to a management center indistinguishably from a case in which the communication to the management center is completed within a predetermined period when it is impossible to complete the communication to the management center within the predetermined period. By switching an operation mode, a predetermined portable terminal is used instead of a communication line to upload and download data. When it is impossible to obtain data required for processing through the communication line, processing is performed based on data possessed up until that time.

Abstract: The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus. Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.

Abstract: A secure area includes a processor that is included in a secure area and a first memory with storage capacity less than a predetermined amount. The processor decrypts, when encrypted first information and encrypted second information are input from a secret input path, the first information and the second information and stores the first information in the first memory. The processor encrypts, by using an encryption key obtained based on the decrypted first information, the decrypted second information and makes a request to store the encrypted second information in a second memory that is present outside the secure area.

Abstract: A pointing support apparatus includes a memory, and a processor coupled to the memory and configured to detect a line-of-sight position of a user on a screen, extract a command included in a search range of the screen with reference to the line-of-sight position, generate a table in which the command and speech information of the command are associated with each other, and decide, when speech information from outside is accepted, a command based on comparison of the recognized speech information and the speech information of the table.

Abstract: A display device includes a display region comprising a plurality of pixels, each pixel of the plurality of pixels comprises a light emitting element which includes a pixel electrode, a conductive layer below the pixel electrode and configured to receive a specified electric voltage, and a thin film transistor below the pixel electrode and the conductive layer, wherein the thin film transistor comprises a semiconductor layer which includes a channel region, a gate electrode which is overlapping the channel region, a first electrode electrically connected to the semiconductor layer and the pixel electrode, and a second electrode electrically connectable to a power supply line, wherein the conductive layer includes an overlapped region which overlaps with the channel region, and the first electrode extends so as to cover the gate electrode at the overlapped region.

Abstract: A pointing support device detects user's gaze position on a screen, sets the gaze position as an initial position of a pointer, displays a path starting from the initial position on the screen on the basis of path definition information, which defines the path to move the pointer and a movement pattern of the path and moves the pointer along the path.

Abstract: There is provided an information processing device including a communication unit configured to receive editing information of content data, an accumulation unit configured to accumulate the editing information, and a control unit configured to control whether to return the editing information to an external device in accordance with a right to use content corresponding to a requestor's identification information included in request information for requesting the editing information, the request information being received from the external device via the communication unit.

Abstract: There is provided an information processing apparatus including a receiver configured to receive a request to perform processing related to a task, from a first information processing apparatus which functions as a client on a network; a scheduler configured to, when a rank of a priority of the scheduler of the information processing apparatus among information processing apparatuses on the network is a first predetermined rank or higher, assign the task to one or a plurality of second information processing apparatuses which function as nodes on the network; and a transmitter configured to transmit a request to execute processing related to the task assigned to the one or the plurality of second information processing apparatuses.

Abstract: According to one embodiment, a display device includes a plurality of pixel units which each includes a light-emitting element and a pixel circuit, a plurality of first scan lines and second scan lines, a plurality of video signal lines, a controller which controls a scan line drive circuit and a signal line drive circuit, wherein the pixel circuit comprises an output switch, a drive transistor, a capacitance, and a pixel switch, wherein the controller controls a reset operation, a cancellation operation, a correction operation, and a light-emitting operation, and the controller deforms a waveform of a control signal which is supplied from the second scan line in a manner that a time of transitioning the pixel switch from an on-state to an off-state is longer than the time of transitioning by a non-deformed control signal, when writing the video voltage signal in the correction operation.