Patents by Inventor Matthew Baker

Matthew Baker has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 7615217
    Abstract: The invention relates to artificial modified proteins, preferably fusion proteins, having a reduced immunogenicity compared to the parent non-modified molecule when exposed to a species in vivo. The invention relates, above all, to novel immunoglobulin fusion proteins which essentially consist of an immunoglobulin molecule or a fragment thereof covalently fused via its C-terminus to the N-terminus of a biologically active non-immunoglobulin molecule, preferably a polypeptide or protein or a biologically active fragment thereof. In a specific embodiment, the invention relates to fusion proteins consisting of an Fc portion of an antibody which is fused as mentioned to the non-immunological target molecule which elicits biological or pharmacological efficacy. The molecules of the invention have amino acid sequences which are altered in one or more amino acid residue positions but have in principal the same biological activity as compared with the non-altered molecules.
    Type: Grant
    Filed: March 12, 2007
    Date of Patent: November 10, 2009
    Assignee: Merck Patent GmbH
    Inventors: Stephen Gillies, Francis J. Carr, Jones Tim, Graham Carter, Anita Hamilton, Stephen Williams, Marian Hanlon, John Watkins, Matthew Baker, Jeffrey C. Way
  • Patent number: 7615615
    Abstract: The present invention relates a modified human interferon beta (INF?) which is less immunogenic than human INF? (SEQ ID NO: 1) when administered in vivo to a human. The modified human INF? comprises an amino acid residue sequence that differs from SEQ ID NO: 1 by an amino acid residue substitution selected from the group consisting of L57A, L57C, L57D L57E, L57G, L57H, L57K, L57N, L57P, L57Q, L57R, L57S, and L57T and an additional substitution selected from the group consisting of the H140A, H140C, H140G, and H140P.
    Type: Grant
    Filed: March 17, 2008
    Date of Patent: November 10, 2009
    Assignee: Merck Patent GmbH
    Inventors: Francis J. Carr, Graham Carter, Tim Jones, John Watkins, Matthew Baker
  • Publication number: 20090226893
    Abstract: Novel methods of testing the immunogenicity of variant antigens are provided. In particular, methods based on the use of transgenic animals are provided, wherein the transgenic animal is tolerised to a particular antigen and is then exposed to variants of the antigen and immune responses are determined. In one embodiment the transgenic animal is a mouse which is transgenic for human MHC class II molecules and the immunogenicity of libraries of variant antibodies are tested.
    Type: Application
    Filed: November 23, 2005
    Publication date: September 10, 2009
    Applicant: ANTITOPE LIMITED
    Inventor: Matthew Baker
  • Publication number: 20090221024
    Abstract: The present invention relates to novel T cell assay methods, in particular where T cell responses to test antigens are increased by removal of regulatory T cells. Novel assays where the timing of incubation with antigens or other samples is varied in order to optimize detection of T cell responses are described. The invention has particular application for measurement of human T cell responses to pharmaceuticals, allergens, irritants or other substances.
    Type: Application
    Filed: March 2, 2007
    Publication date: September 3, 2009
    Applicant: ANTITOPE LIMITED
    Inventors: Matthew Baker, Francis J. Carr, Alyson Rust, Laura Davies
  • Publication number: 20090178575
    Abstract: A cooking system using a pressurized air system combined with one or more gas or electric heating elements, including an air plenum connected to a source of pressurized air and having one or more arrays of air outlets that produce focused forced air curtains to confine and guide heat from the heating element to the food product.
    Type: Application
    Filed: March 24, 2009
    Publication date: July 16, 2009
    Applicant: NIECO CORPORATION
    Inventors: Edward Baker, Matthew Baker, Patrick Baker, Mohsen Sarfehjoo, Erik Magne
  • Publication number: 20090181146
    Abstract: A cooking system for cooking foods using a combination of magnetic induction, convection and radiant heat, including a magnetic induction stage proximate the inlet end of a cooking chamber in which food is cooked by convention and radiant heating. A conveyor system, either continuous or configured in stages, passes food from the magnetic induction heating stage to and through the radiant and convention heating stages.
    Type: Application
    Filed: March 24, 2009
    Publication date: July 16, 2009
    Applicant: NIECO CORPORATION
    Inventors: EDWARD BAKER, MATTHEW BAKER, PATRICK BAKER, MOHSEN SARFEHJOO, ERIK MAGNER
  • Patent number: 7541439
    Abstract: The invention concerns human thrombopoietin and in particular modified forms of thrombopoietin (TPO) with improved properties. The improved proteins contain amino acid substitutions at specific positions within the TPO molecule. The invention provides modified TPO molecules, preferably fusion proteins comprising immunoglobulin constant regions and modified human TPO, with improved biological activity concomitant with reduced immunogenic potential in the protein. The improved proteins are intended for therapeutic use in the treatment of diseases in humans.
    Type: Grant
    Filed: June 25, 2004
    Date of Patent: June 2, 2009
    Assignee: Merck Patent GmbH
    Inventors: Matthew Baker, John Watkins
  • Patent number: 7524502
    Abstract: The invention relates to the modification of antibodies reactive to human tumor necrosis factor alpha (TNF alpha) to result in anti-TNF alpha antibodies that are substantially non-immunogenic or less immunogenic than any non-modified parental antibody when used in vivo. The invention relates also to peptide molecules comprising T-cell epitopes of the V-regions of the parental antibody which are modified by amino acid alteration in order to reduce or eliminate said T-cell epitopes.
    Type: Grant
    Filed: November 11, 2002
    Date of Patent: April 28, 2009
    Assignee: Merck Patent GmbH
    Inventors: Koen Hellendoorn, Matthew Baker, Francis J. Carr
  • Patent number: 7501500
    Abstract: A solution for treating a nucleic acid duplex having a pH of from 3 to 11, comprising a soluble protein or mixture of proteins; and 0.1 mM to 10 mM divalent cations; wherein the nature and concentration of the protein or mixture of proteins is selected so that the solution is capable of inhibiting heat denaturation of a nucleic acid product.
    Type: Grant
    Filed: June 5, 2007
    Date of Patent: March 10, 2009
    Assignee: Whatman, Inc.
    Inventors: Neil Butt, Matthew Baker, Navin Deepal Pathirana
  • Patent number: 7501113
    Abstract: A liquid aerosol formulation comprising at least one thermally stable active ingredient selected from the group consisting of buspirone, buprenorphine, triazolam, cyclobenzaprine, zolpidem, pharmaceutically acceptable salts and esters thereof and derivatives thereof. The liquid formulation can include an organic solvent such as propylene glycol and one or more optional excipients. The active ingredient can be present in an amount of 0.01 to 5 wt. % and the formulation can be heated to provide a vapor which forms an aerosol having a mass median aerodynamic diameter of less than 3 ?m.
    Type: Grant
    Filed: December 15, 2003
    Date of Patent: March 10, 2009
    Assignee: Philip Morris USA Inc.
    Inventors: Frank E. Blondino, Justin Poklis, Matthew Baker
  • Publication number: 20090043076
    Abstract: The present invention relates a modified human interferon beta (INF?) which is less immunogenic than human INF? (SEQ ID NO: 1) when administered in vivo to a human. The modified human INF? comprises an amino acid residue sequence that differs from SEQ ID NO: 1 by an amino acid residue substitution selected from the group consisting of L57A, L57C, L57D L57E, L57G, L57H, L57K, L57N, L57P, L57Q, L57R, L57S, and L57T and an additional substitution selected from the group consisting of the H140A, H140C, H140G, and H140P.
    Type: Application
    Filed: March 17, 2008
    Publication date: February 12, 2009
    Inventors: Francis J. Carr, Graham Carter, Tim Jones, John Watkins, Matthew Baker
  • Publication number: 20090005000
    Abstract: A system and method for the real-time management of a device, and more particularly to the allocation of electronic wallets that are associated with one or more devices and various controls that enable at least two entities to manage how the device is utilized for various activities and to pay for goods and services. Each device is associated with at least two electronic wallets, a user wallet and an administrator wallet. The administrator can establish rules that designate how and when the device can be used and which wallet will be used to pay for goods and services desired by the user, but in the event the user wallet is depleted or low on funds, the administrator wallet can serve as a backup funding source for specified types of goods and/or services.
    Type: Application
    Filed: June 28, 2007
    Publication date: January 1, 2009
    Applicant: Kajeet, Inc.
    Inventors: Matthew Baker, Steven Geller, Douglas Kesser, Daniel Neal, Carol Politi, Ben Weintraub
  • Publication number: 20090006116
    Abstract: A system and method for the real-time management of a device, and more particularly to the establishment and enforcement of policies or rules associated with the feature or functions that may be performed with the device. Modern communication devices are capable of many things, including making and receiving calls, exchanging data, playing games and music, sending and receiving email, accessing web sites, and paying for goods and services. Depending on who is using the communication device, such as a child or an employee, there may be a need or desire to regulate how that communication device can be used and to determine who will pay for what goods or services. In addition to providing all of the features associated with a device, service providers need to be able to establish and enforce rules (policies) regulating how and when that device can be used and who will pay for a good or service requested by the user of the device.
    Type: Application
    Filed: July 26, 2007
    Publication date: January 1, 2009
    Applicant: Kajeet, Inc.
    Inventors: Matthew Baker, Steven Geller, Douglas Kesser, Daniel Neal, Carol Politi, Ben Weintraub
  • Publication number: 20090006200
    Abstract: A system and method for the real-time management of a device, and more particularly to the allocation of electronic wallets that are associated with one or more devices and various controls that enable at least two entities to manage how the device is utilized for various activities and to pay for goods and services. Each device is associated with at least two electronic wallets, a user wallet and an administrator wallet. The administrator can establish rules that designate how and when the device can be used and which wallet will be used to pay for goods and services desired by the user, but in the event the user wallet is depleted or low on funds, the administrator wallet can serve as a backup funding source for specified types of goods and/or services.
    Type: Application
    Filed: February 6, 2008
    Publication date: January 1, 2009
    Applicant: Kajeet, Inc.
    Inventors: Matthew Baker, Steven Geller, Douglas Kesser, Daniel Neal, Carol Politi, Ben Weintraub
  • Patent number: 7456257
    Abstract: The invention concerns human interferon alpha and in particular modified forms of interferon alpha 2 with improved properties. The improved proteins contain amino acid substitutions at specific positions that confer increased relative activity in biological assays. The invention provides also modified interferon alpha with improved biological activity concomitant with reduced immunogenic potential in the protein. The improved proteins are intended for therapeutic use in the treatment of diseases in humans.
    Type: Grant
    Filed: February 18, 2004
    Date of Patent: November 25, 2008
    Assignee: Merck Patent GmbH
    Inventors: Tim Jones, Matthew Baker, Marian Hanlon, Francis Joseph Carr
  • Publication number: 20080261202
    Abstract: Polyfunctional reagents are disclosed that are capable of reversibly binding to target substances, for example nucleic acid, proteins, polypeptides, cells, cell components, microorganisms or viruses, for use in purifying or otherwise manipulating them. The reagents comprise a tagging group for manipulating and/or detecting the target substance when bound to the polyfunctional reagent. The polyfunctional reagents work by binding the target substance at a first pH and then releasing it at a second pH, usually higher than the first. Examples of tagging groups include tagging group members of a specific binding pair which is capable of binding to a specific binding partner and/or a label.
    Type: Application
    Filed: March 27, 2008
    Publication date: October 23, 2008
    Applicant: INVITROGEN CORPORATION
    Inventors: Matthew Baker, Simon Douglas, Elliot Lawrence
  • Patent number: 7425533
    Abstract: Modified forms of hirudin having improved properties are disclosed. The modified hirudin compounds are hirudin variants comprising amino acid substitutions in the sequence of hirudin. Peptide molecules consisting of the amino acid residue sequence CILGSDGEKNQCVTGEGTPKPESHNDGDFE (SEQ ID NO: 1) or a sequence consisting of at least 9 consecutive amino acid residues of SEQ ID NO: 1 having a potential MHC class II binding activity are disclosed. The peptide has a stimulation index of >1.8 in a biological assay of cellular proliferation, in which the index is defined as the value of cellular proliferation scored following stimulation by the peptide and divided by the value of cellular proliferation scored in control cells that have not been exposed to the peptide.
    Type: Grant
    Filed: June 25, 2004
    Date of Patent: September 16, 2008
    Assignee: Merck Patent GmbH
    Inventors: Matthew Baker, John Watkins
  • Publication number: 20080219994
    Abstract: The invention provides modified forms of bouganin protein having biological activity and a reduced propensity to activate human T cells as compared to the non-modified bouganin protein. The invention also provides T-cell epitope peptides of bouganin, and modified T-cell epitope peptides of bouganin which have a reduced propensity to activate human T cells as compared to the non-modified T-cell epitope peptide. The invention also provides cytotoxins having the having a ligand that binds to a cancer cells attached to the modified bouganin proteins. Also provided are methods of inhibiting or destroying mammalian cancer cells using the cytotoxins of the invention and pharmaceutical compositions for treating human cancer.
    Type: Application
    Filed: January 9, 2008
    Publication date: September 11, 2008
    Inventors: Matthew Baker, Francis J. Carr, Koen Hellendoorn, Jeannick Cizeau, Glen Christopher MacDonald, Joycelyn Entwistle, Denis Georges Bosc, Nicholas Ronald Glover
  • Patent number: 7410635
    Abstract: A liquid aerosol formulation comprising at least one thermally stable active ingredient selected from the group consisting of butalbital, lorazepam, ipratropium, baclofen, morphine, scopolamine, pharmaceutically acceptable salts and esters thereof and derivatives thereof. The liquid formulation can include an organic solvent such as propylene glycol and one or more optional excipients. The active ingredient can be present in an amount of 0.01 to 5 weight percent and the formulation can be heated to provide a vapor which forms an aerosol having a mass median aerodynamic diameter of less than 3 ?m.
    Type: Grant
    Filed: October 6, 2004
    Date of Patent: August 12, 2008
    Assignee: Philip Morris USA Inc.
    Inventors: Frank E. Blondino, Justin Poklis, Matthew Baker
  • Patent number: 7381795
    Abstract: A modified interferon beta (INF?) is provided, which is less immunogenic than human INF? (SEQ ID NO: 1) when administered to a human in vivo. The modified INF? comprises an amino acid residue sequence that differs from SEQ ID NO: 1 by a substitution at one or more residues of SEQ ID NO: 1. Preferred substitutions are at residues selected from the group consisting of residue 50, 59, 60, 62, 63, 66, 67, 69, 70, 125, 126, 129, 130, 132, 133, and 138. Examples of suitable substitutions include F50A, L57A, I59A, Y60N, M62A, L63A, I66T, F67H, I69A, F70A, Y125A, Y126A, I129A, L130A, Y132S, L133A, Y138H, and Y138A.
    Type: Grant
    Filed: March 15, 2002
    Date of Patent: June 3, 2008
    Assignee: Merck Patent GmbH
    Inventors: Francis J. Carr, Graham Carter, Tim Jones, John Watkins, Matthew Baker