Abstract: A touch panel including a first substrate and a sensing electrode is provided. The sensing electrode includes a first metal layer, a metal second metal layer, a metal nitride layer, and a metal oxide layer. The first metal layer is disposed on the first substrate and includes a first metallic element. The second metal layer includes a second metallic element. The metal nitride layer includes the second metallic element and is disposed on the second metal layer. The metal oxide layer is disposed on the metal nitride layer.

Abstract: The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGS VEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.

Abstract: The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.

Abstract: A cord winding structure for window blind includes a cord winding assembly composed of a first and a second plate member, a guide rod, a first and a second shaft, a first and a second guiding wheel, and a spiral spring. The first plate member has a guide rod support bracket unit upward projected from one side thereof for supporting the guide rod thereon. The second plate member has a plurality of pulley sets provided thereon. The first and second guiding wheels are rotatably connected to between the first and the second plate member via the first and the second shaft, respectively. The spiral spring is fitted to one side of the second guiding wheel with an end extended to fasten to the first guiding wheel. A first cord is wound around the guide rod, the pulley sets and a first cord receiving groove of the first guiding wheel.

Abstract: This invention provides a calibration method and a corresponding apparatus for optical imaging lens system with double optical paths. The apparatus for optical imaging lens system with double optical paths comprises a first optical subsystem, a second optical subsystem and a calibration module. The calibration module receives a first image data from the first optical subsystem and a second image data from the second optical subsystem. The calibration module calibrates the first image data according to at least one selected optical parameter of the second optical subsystem, and calibrates the second image data according to at least one selected optical parameter of the first optical subsystem. The selected optical parameters of the first optical subsystem and the second optical subsystem are different.

Abstract: A planar antenna and a handheld device are provided. The handheld device includes the planar antenna and a system ground plane. The planar antenna has a first feed point, a first ground point, a second feed point, and a second ground point. The first ground point and the second ground point are located between the first feed point and the second feed point. The system ground plane is electrically connected to the first feed point, the first ground point, the second feed point, and the second ground point. Thereby, the performance in radio signal transceiving is improved.

Abstract: An imagery axle turning method for stereo vision and an apparatus thereof. The method turns an imagery axle of a stereo vision apparatus to capture images, and constructs a 3D image from the captured 2D images. The imagery axle turning method is realized by rotating the imagery axles of the first lens unit and second lens unit to an angle ?, so as to have different aspect ratios for the first image and second image. Thereby, the 3D image formed from the stereo vision reconstruction steps can achieve a user's expectation of capturing images with an appropriate aspect ratio. This invention also provides specific stereo vision apparatus corresponding to various applications by the imagery axle turning method.

Abstract: An improved portable aquarium filter structure has a box body, wherein its inside has a submersible pump externally connected to an air pipe. Air enters the submersible pump through the air pipe to mix with water flow pumped by the submersible pump so as to produce bubbles. Accordingly, water flow can be treated with bubble removing and purification. A bubble collection box is disposed on the box body to collect filth that is treated with bubble removing, wherein an opening is disposed on the bubble collection box. A converged taper section is disposed at the opening wall of the opening extended toward the box body therein. The filth is decomposed to produce carbon dioxide and acid gas by a protein decomposition unit disposed in the bubble collection box to attract mosquitoes entering the Trap through the tapered opening so as to achieve a goal of catching mosquitoes.

Abstract: A cord winding structure for window blind includes a cord winding assembly composed of a first and a second plate member, a guide rod, a first and a second shaft, a first and a second guiding wheel, and a spiral spring. The first plate member has a guide rod support bracket unit upward projected from one side thereof for supporting the guide rod thereon. The second plate member has a plurality of pulley sets provided thereon. The first and second guiding wheels are rotatably connected to between the first and the second plate member via the first and the second shaft, respectively. The spiral spring is fitted to one side of the second guiding wheel with an end extended to fasten to the first guiding wheel. A first cord is wound around the guide rod, the pulley sets and a first cord receiving groove of the first guiding wheel.

Abstract: The present invention provides an optical imaging lens system with double optical paths, comprising: the first optical subsystem; the second optical subsystem having a back focal length equal to that of the first optical subsystem; an optical path selector selectively having a light reflection state or a light passing state; the first reflector set disposed at an image side of the first optical subsystem for directing light from the first optical subsystem to the optical path selector; and the second reflector set disposed at an image side of the second optical subsystem for directing light from the second optical subsystem to the optical path selector. In the present invention, the optical path selector can be controlled to have the light reflection state or the light passing state selectively, so that an image coming from the first optical subsystem or from the second optical subsystem is captured.

Abstract: This invention provides a calibration method and a corresponding apparatus for optical imaging lens system with double optical paths. The apparatus for optical imaging lens system with double optical paths comprises a first optical subsystem, a second optical subsystem and a calibration module. The calibration module receives a first image data from the first optical subsystem and a second image data from the second optical subsystem. The calibration module calibrates the first image data according to at least one selected optical parameter of the second optical subsystem, and calibrates the second image data according to at least one selected optical parameter of the first optical subsystem. The selected optical parameters of the first optical subsystem and the second optical subsystem are different.

Abstract: This invention provides a calibration method and a corresponding apparatus for optical imaging lens system with double optical paths. The apparatus for optical imaging lens system with double optical paths comprises a first optical subsystem, a second optical subsystem and a calibration module. The calibration module receives a first image data from the first optical subsystem and a second image data from the second optical subsystem. The calibration module calibrates the first image data according to at least one selected optical parameter of the second optical subsystem, and calibrates the second image data according to at least one selected optical parameter of the first optical subsystem. The selected optical parameters of the first optical subsystem and the second optical subsystem are different.

Abstract: A portable electronic device includes a main body, a casing and a supporting unit. The casing is detachably connected to the main body. The supporting unit is connected to the casing and is rotatable relative to the casing. When the supporting unit rotates to a first position, the supporting unit supports the main body. When the supporting unit rotates to a second position, the casing and the main body are separated.

Abstract: A mobile terminal and a method for securing information are provided. The mobile terminal includes an application part to receive information related to an application; a determining unit to receive a command issued by the application and to determine whether the command or the application is authorized to access a system resource of the mobile terminal; and a blocking unit to block an execution of the command in response to a determination that the execution of the command is unauthorized or issued by the unauthorized application. The method includes receiving information related to an application; receiving a request for executing a command issued by the application; determining whether the requested command or the application is authorized to access a system resource of a mobile terminal; and blocking execution of the command in response to a determination that the execution of the command is unauthorized or issued by an unauthorized application.

Abstract: A PIFA/monopole hybrid antenna includes a high-frequency radiator, a low-frequency radiator, a connecting part, a feed part, and a ground part. The high-frequency radiator includes a first radiating part and a second radiating part extended substantially perpendicular to the first radiating part. The low-frequency radiator includes a third radiating part extended substantially parallel to the first radiating part, and a fourth radiating part extended substantially perpendicular to the third radiating part. The connecting part is connected between the high-frequency radiator, the low-frequency radiator, the connecting part, the feed part, and the ground part.

Abstract: A mobile terminal and a method for securing information are provided. The mobile terminal includes an application part to receive information related to an application; a determining unit to receive a command issued by the application and to determine whether the command or the application is authorized to access a system resource of the mobile terminal; and a blocking unit to block an execution of the command in response to a determination that the execution of the command is unauthorized or issued by the unauthorized application. The method includes receiving information related to an application; receiving a request for executing a command issued by the application; determining whether the requested command or the application is authorized to access a system resource of a mobile terminal; and blocking execution of the command in response to a determination that the execution of the command is unauthorized or issued by an unauthorized application.