Abstract: A polyester prepared by free radical polymerization of an unsaturated polyester prepolymer, wherein the polymerization occurs primarily by reaction of the unsaturation of said prepolymer is disclosed. Coatings comprising the same are also disclosed, as are substrates coated at least in part with such coating.

Abstract: The present disclosure describes a system and method to classify optical coherence tomography (OCT) images. The present system can classify OCT images without first segmenting the retina tissue. The system can generate one or more profiles from vertical transects through the OCT images. The system can identify image statistics based on the one or more profiles. The system's classifier can then classify the OCT images based on the identified image statistics.

Abstract: Coating compositions that include a binder formed from a polyester and a phosphorus acid are disclosed. The binder includes a polyester material formed as the reaction product of a polyacid, a polyol, and a phosphorous acid, wherein the polyester material has a number-average molecular weight (Mn) from about 1,000 Da to 25,000 Da and a polydispersity index (Mw/Mn) of from about 1 to 10. The polyester material is present in the binder composition in amounts of more than about 10 weight percent (wt %). The coating compositions are useful for coating food and/or beverage containers.

Abstract: A non-obtrusive oncoming emergency vehicle prewarning system includes a transmitting unit installed in an emergency vehicle that transmits a one-way signal, a plurality of receiving units mounted on a dashboard of civilian vehicles that receives the signal transmitted from the emergency vehicle, and a compact visual and audio display unit that informs a motorist of the civilian vehicles of the relative position of the emergency vehicle such that the motorist has advance warning of the emergency vehicle that is oncoming and is able to move to a side of the road allowing the emergency vehicle to safely pass.

Abstract: The present disclosure generally relates to an insulating device, for example a cooler, and a latch and latching system for securing a lid of the insulating device in a closed position. More specifically, the insulating device includes a chest coupled to a lid, and a ledge extending from the chest. A slot is formed in the ledge and for each slot, a pair of protrusions extend from a bottom surface of the ledge on other side of the slot. The protrusions are received by corresponding recesses formed in the latch. Thus, when the latch is in the engaged position, the protrusions are physically securely engaged in the recesses by virtue of the latch being in a tensioned configuration.

Abstract: Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.

Abstract: Embodiments of the invention improve the performance, safety, and efficiency of the gasification process. Embodiments of the invention improve downdraft gasification by improving upon the systems and methods for fuel preparation and by addressing gasifier bridging and channeling. Unique parts of the system include a unique hearth and grate design, a programmable logic controller and interface for managing the gasification process, an improved filtration system, a unique system for eliminating mist, a unique system for cooling gas, a unique combined flare, an integrated auger system, and a new system and method for sampling gas.

Abstract: A polyester prepared by free radical polymerization of an unsaturated polyester prepolymer, wherein the polymerization occurs primarily by reaction of the unsaturation is disclosed. Coatings comprising the same are also disclosed, as are substrates coated at least in part with such coatings.

Abstract: A paving machine for spreading, leveling and finishing concrete having a main frame, center module, bolsters laterally movably, and a crawler track associated with respective aft and forward ends of the bolsters. A bolster swing leg for each crawler track supports an upright jacking column. A worm gear drive permits rotational movements of the crawler track and the jacking column. A hinge bracket is interposed between each swing leg and a surface of the bolsters to enable pivotal movements of the swing leg. A length-adjustable holder engages the pivot pin on the hinge bracket and pivotally engages the swing leg. The holder permits pivotal motions of the swing leg in its length-adjustable configuration and prevents substantially any motion of the swing leg in its fixed-length configuration. A feedback loop cooperates with transducers keeping the crawler tracks position. The paving machine can be reconfigured into a narrowed transport configuration.

Abstract: A low power control and monitoring network that is easy to setup operates using devices connected to a wired medium, each device having: unique identification, a CPU with a minimum power consumption state while powered by a power supply; a digital memory storing a resource management file of the device, a transceiver controllable by the CPU for communication on the wired medium wherein the transceiver is in an OFF state when the CPU is in the minimum power consumption state, a wakeup circuit generating a pulse of predetermined data or pulse characteristics for waking up the CPU and transceiver and for waking up the CPU of another device, the wake up resulting from the use of the communication of data including an address of the device on the network and to enable communication of a resource management file of at least one device to the other device.

Abstract: A non-obtrusive oncoming emergency vehicle prewarning system includes a transmitting unit installed in an emergency vehicle that transmits a one-way signal, a plurality of receiving units mounted on a dashboard of civilian vehicles that receives the signal transmitted from the emergency vehicle, and a compact visual and audio display unit that informs a motorist of the civilian vehicles of the relative position of the emergency vehicle such that the motorist has advance warning of the emergency vehicle that is oncoming and is able to move to a side of the road allowing the emergency vehicle to safely pass.

Abstract: A paving machine for spreading, leveling and finishing concrete having a main frame, center module, bolsters laterally movably, and a crawler track associated with respective aft and forward ends of the bolsters. A bolster swing leg for each crawler track supports an upright jacking column. A worm gear drive permits rotational movements of the crawler track and the jacking column. A hinge bracket is interposed between each swing leg and a surface of the bolsters to enable pivotal movements of the swing leg. A length-adjustable holder engages the pivot pin on the hinge bracket and pivotally engages the swing leg. The holder permits pivotal motions of the swing leg in its length-adjustable configuration and prevents substantially any motion of the swing leg in its fixed-length configuration. A feedback loop cooperates with transducers keeping the crawler tracks position. The paving machine can be reconfigured into a narrowed transport configuration.

Abstract: An electrical device having a bus side and a load side is provided. The electrical device includes a plurality of conductive line terminals disposed on the bus side of said electrical device, and a plurality of electrical connectors. Each electrical connector of the plurality of electrical connectors includes a first end coupled to a respective line terminal of the plurality of line terminals, a second end distal from the first end, and a connector clip disposed at the second end. Each connector clip is configured to engage a bus bar to electrically couple the electrical device to the bus bar, and includes a first contact segment and a second contact segment spaced apart from the first contact segment. The first and second contact segments are configured to deflect towards one another from a relaxed position to a depressed position when inserted into a connector channel defined by the bus bar.

Abstract: Embodiments disclosed include a system comprising a missile segment having an external surface conforming to a portion of an external surface of a missile body. The missile segment comprising a plurality of chemical plasma dispensing units (CPDUs) having a chemical plasma reactant (CPR). Each CPDU is addressable so that a group of selected CPDUs in an area is ignited simultaneously to cause a first reaction to push CPR particles into a flow stream surrounding the missile body. The CPR particles to complete a second reaction in the flow stream over a reaction time period to effectuate production of expanding hot gas energy caused by heating air in the flow stream and gaseous reaction products over the missile body to provide an amount of a steering force to change one or more of six degrees of freedom at a location on the body. A missile and method are also provided.

Abstract: A paving machine for spreading, leveling and finishing concrete having a main frame, center module, bolsters laterally movably, and a crawler track associated with respective aft and forward ends of the bolsters. A bolster swing leg for each crawler track supports an upright jacking column. A worm gear drive permits rotational movements of the crawler track and the jacking column. A hinge bracket is interposed between each swing leg and a surface of the bolsters to enable pivotal movements of the swing leg. A length-adjustable holder engages the pivot pin on the hinge bracket and pivotally engages the swing leg. The holder permits pivotal motions of the swing leg in its length-adjustable configuration and prevents substantially any motion of the swing leg in its fixed-length configuration. A feedback loop cooperates with transducers keeping the crawler tracks position. The paving machine can be reconfigured into a narrowed transport configuration.

Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami

Abstract: This invention discloses a multispectral imaging system, DFPA (digital focal plane array), in the form of an integrated circuit of three structures each of which is implemented on a chip. The top structure consists of detectors capable of imaging in the visible to LWIR wavelengths. The middle structure of neuromorphic focal array contains ROI circuitry and inherent computing capabilities for digitization, convolution, background suppression, thresholding, and centroid determination of the ROIs. The bottom structure (dubbed common digital layer) is capable of additional image processing tasks and reconfiguring the neuromorphic focal array. In a simpler embodiment of the invention, the system only has the top two layers, with an external processor taking over the role of the common digital layer.

Abstract: The present disclosure describes a system and method to segment optical coherence tomography (OCT) images. The present system uses a hybrid method that employs both Bayesian level sets (BLS) and graph-based segmentation algorithms. The system first identifies retinal tissue within an OCT image using the BLS algorithms. The identified retinal tissue is then further segmented using the graph-based segmentation algorithms.

Abstract: A paving machine for spreading, leveling and finishing concrete having a main frame, center module, bolsters laterally movably, and a crawler track associated with respective aft and forward ends of the bolsters. A bolster swing leg for each crawler track supports an upright jacking column. A worm gear drive permits rotational movements of the crawler track and the jacking column. A hinge bracket is interposed between each swing leg and a surface of the bolsters to enable pivotal movements of the swing leg. A length-adjustable holder engages the pivot pin on the hinge bracket and pivotally engages the swing leg. The holder permits pivotal motions of the swing leg in its length-adjustable configuration and prevents substantially any motion of the swing leg in its fixed-length configuration. A feedback loop cooperates with transducers keeping the crawler tracks position. The paving machine can be reconfigured into a narrowed transport configuration.

Abstract: Disclosed is a device for separating a cellular component from a multicomponent fluid. The device can comprise a body, a first acoustic wave generator, and a second acoustic wave propagating component. The body can define a channel having a first surface and a second surface opposite the first surface. The channel can extend along a longitudinal axis from a first end to a second end. The first acoustic wave generator can be coupled to the first surface. The first acoustic wave generator can be configured to generate an acoustic wave having a wavelength. The second acoustic wave propagating component can be coupled to the second surface. The second surface can be spaced an integer fractional multiple of the wavelength from the first surface and each integer factional multiple equals a number of pressure nodes within the channel.