Abstract: Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.

Abstract: A method for effecting a near field communication, including the steps of positioning a first device at a close proximity to a second device, wherein the close proximity is suitable for the near field communication; and sending a first effectively carrierless signal from the first device to the second device.

Abstract: The present invention relates to a binding molecule that specifically binds to two different epitopes of an antigen expressed on tumor cells, wherein the binding molecule comprises: (a) a first binding (poly)peptide that specifically binds to a first epitope of said antigen expressed on tumor cells, wherein said first binding (poly)peptide is a Fyn SH3-derived polypeptide; and (b) a second binding (poly)peptide that specifically binds to a second epitope of said antigen expressed on tumor cells. The present invention further relates to a nucleic acid molecule encoding the binding molecule of the invention, a vector comprising said nucleic acid molecule as well as a host cell or a non-human host transformed with said vector. The invention further relates to a method of producing a binding molecule of the invention as well as to pharmaceutical and diagnostic composition.

Abstract: A coating composition for a food and/or beverage container comprising a polyester material, wherein the polyester material comprises the reaction product of a two step process, the two step process comprising: a first step comprising preparing a polyester prepolymer by contacting (a) 1,2-propanediol, (b) terephthalic acid, and a second step comprising contacting the polyester prepolymer with (c) a molecular weight increasing agent, characterised in that the polyester material has a number-average molecular weight (Mn) of at least 6,100 Da and a glass transition temperature (Tg) of at least 80° C.

Abstract: A coating composition for a food and/or beverage container comprising a polyester material, the polyester material comprising the reaction product of; (a) 1,2-propanediol, (b) terephthalic acid, and (c) a molecular weight increasing agent, characterised in that the polyester material has a number-average molecular weight (Mn) of at least 6,100 Da and a glass transition temperature (Tg) of at least 80° C., wherein the molecular weight increasing agent comprises a polyacid, a polyol or a combination thereof, the polyacid comprises a diacid of formula (I) wherein each R independently represents hydrogen or an alkyl, alkenyl, alkynyl, or aryl group; n=0 or 1; X represents a bridging group selected from: an alkylene group; an alkenylene group; an alkynylene group; an arylene group; the bridge between the —COOR groups is C1 or C2, and the hydroxyl groups of the polyol are connected by a C1 to C3 alkylene group.

Abstract: Disclosed is a device for separating a cellular component from a multicomponent fluid. The device can include a body, a first acoustic wave generator, and a second acoustic wave propagating component. The body can define a channel having a first surface, an opposing second surface, a first side, and an opposing second side. The channel can extend along a longitudinal axis from a first end to an opposing second end. The first acoustic wave generator can be coupled to the first surface. The second acoustic wave propagating component can be coupled to the second surface. The first acoustic wave generator and second acoustic wave propagating component can be configured to generate a bulk standing acoustic wave in the channel.

Abstract: A paving machine for spreading, leveling and finishing concrete having a main frame, center module, bolsters laterally movably, and a crawler track associated with respective aft and forward ends of the bolsters. A bolster swing leg for each crawler track supports an upright jacking column. A worm gear drive permits rotational movements of the crawler track and the jacking column. A hinge bracket is interposed between each swing leg and a surface of the bolsters to enable pivotal movements of the swing leg. A length-adjustable holder engages the pivot pin on the hinge bracket and pivotally engages the swing leg. The holder permits pivotal motions of the swing leg in its length-adjustable configuration and prevents substantially any motion of the swing leg in its fixed-length configuration. A feedback loop cooperates with transducers keeping the crawler tracks position. The paving machine can be reconfigured into a narrowed transport configuration.

Abstract: An electrical device having a bus side and a load side is provided. The electrical device includes a plurality of conductive line terminals disposed on the bus side of said electrical device, and a plurality of electrical connectors. Each electrical connector of the plurality of electrical connectors includes a first end coupled to a respective line terminal of the plurality of line terminals, a second end distal from the first end, and a connector clip disposed at the second end. Each connector clip is configured to engage a bus bar to electrically couple the electrical device to the bus bar, and includes a first contact segment and a second contact segment spaced apart from the first contact segment. The first and second contact segments are configured to deflect towards one another from a relaxed position to a depressed position when inserted into a connector channel defined by the bus bar.

Abstract: An electrical distribution apparatus is provided. The electrical distribution apparatus includes a stacked bus bar assembly including a plurality of bus bars. Each bus bar includes a first plate, a second plate spaced from the first plate in a first direction, and an intermediate member disposed between and interconnecting the first plate and the second plate. At least one of the first plate and said second plate is constructed of an electrically conductive material.

Abstract: A paving machine for spreading, leveling and finishing concrete having a main frame, center module, bolsters laterally movably, and a crawler track associated with respective aft and forward ends of the bolsters. A bolster swing leg for each crawler track supports an upright jacking column. A worm gear drive permits rotational movements of the crawler track and the jacking column. A hinge bracket is interposed between each swing leg and a surface of the bolsters to enable pivotal movements of the swing leg. A length-adjustable holder engages the pivot pin on the hinge bracket and pivotally engages the swing leg. The holder permits pivotal motions of the swing leg in its length-adjustable configuration and prevents substantially any motion of the swing leg in its fixed-length configuration. A feedback loop cooperates with transducers keeping the crawler tracks position. The paving machine can be reconfigured into a narrowed transport configuration.

Abstract: The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.

Abstract: Mechanisms for identifying a characteristic of a material. An X-ray signal is generated. The X-ray signal is modulated with at least two radio frequency modulation signals to form a modulated X-ray signal. The modulated X-ray signal is directed toward a target material. A backscatter signal is received from the target material, the backscatter signal including harmonic components generated by the target material in response to receiving the modulated X-ray signal. Based at least in part on the harmonic components, a characteristic of the target material is identified.

Abstract: The invention relates generally to remote controls with graphical user interfaces and user input mechanisms that are used to control the state of one or more other devices. The invention includes a meta-state widget provided on a remote control device to indicate a condition of the state of an application widget also on the device. An application widget provides on the remote control a visual icon such as a push button, slider, check box or other kind of icon that commonly appears on a graphical user interface. An application widget may be used to send a command to an associated entity to cause it to change state. In general an associated entity may be a physical device such as a PVR, or a software element such as a program or a component of a program. The conditions that may be indicated on the remote control device by the meta-state widget are: UNCONFIRMED, CONFIRMED, UNKNOWN and IN-ERROR.

Abstract: An apparatus (10) for exercise in which a user strikes the apparatus (10), the apparatus (10) including: a body (12) and a sensor assembly (16) located at least partially within the body (12); wherein the sensor assembly (16) includes pressure sensor (18) having a fluid filled housing (95) with a flexible surface (93), the sensor assembly (16) being configured to generate an impact signal associated with deflection of the flexible surface (93) of the pressure sensor (18), and wherein the flexible surface (93) of the pressure sensor (18) is positioned relative to a striking portion (14) of the body (12) such that impacting the striking portion (14) of the body (12) deflects the flexible surface of the pressure sensor (18) thereby generating the impact signal.

Abstract: The presently disclosed technique provides a method and apparatus for use in modulated X-ray harmonic detection and identification. More specifically, it specifies a X-ray backscatter imaging system using radio frequency modulation of the incident X-ray beam at two frequencies and detection patterns in the backscattered signal corresponding to harmonics of the modulation frequencies.

Abstract: A valve has a moveable member movable between open and closed configurations and a cutting device arranged to shear against an anvil member when moving between the open and closed configurations and a sealing member providing a seat for seating of the moveable member when the moveable member is in the closed configuration. The anvil member and the sealing member are moveable relative to one another when the moveable member is moving from the open to the closed configuration. During opening and closing the sealing member is displaced away from the cutting device as the cutting device engages the anvil member. The sealing member is pushed away from the moveable member and the anvil to a maximum separation from the movable member at the point on the stroke when the cutting surface of the moveable member is moving past the anvil member.

Abstract: The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.

Abstract: A thermally insulating package comprises an outer shell (6) formed from a foam insulating material, a plurality of vacuum insulated panels (12) removably received on the walls of the outer shell (6) and a plurality of phase change material panels (18) arranged within the vacuum insulated panels (12) to define a payload space.

Abstract: A thermally insulating package comprises an outer shell (6) formed from a foam insulating material, a plurality of vacuum insulated panels (12) removably received on the walls of the outer shell (6) and a plurality of phase change material panels (18) arranged within the vacuum insulated panels (12) to define a payload space.