Patents by Inventor Sandra Steiner

Sandra Steiner has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20100099138
    Abstract: This application discloses a multivalent opsonophagocytosis assay that does not rely on counting of bacterial colonies to determine bacteria viability following opsonophagocytosis. Instead, the method uses a metabolic colorimetric indicator to determine if viable bacteria are present. Also disclosed are arrays that can be used to determine the viability of bacteria following opsonophagocytosis.
    Type: Application
    Filed: November 18, 2009
    Publication date: April 22, 2010
    Inventors: Sandra STEINER, Patricia F. HOLDER, George M. CARLONE, GowriSankar RAJAM
  • Patent number: 7642068
    Abstract: This application discloses a multivalent opsonophagocytosis assay that does not rely on counting of bacterial colonies to determine bacteria viability following opsonophagocytosis. Instead, the method uses a metabolic colorimetric indicator to determine if viable bacteria are present. Also disclosed are arrays that can be used to determine the viability of bacteria following opsonophagocytosis.
    Type: Grant
    Filed: April 21, 2006
    Date of Patent: January 5, 2010
    Assignee: The United States of America as represented by the Department of Health and Human Services, Center for Disease Control and Prevention
    Inventors: Sandra Steiner, Patricia F. Holder, George M. Carlone, GowriSankar Rajam
  • Publication number: 20080305123
    Abstract: Provided is a P4 peptide, which contains functional epitopes of the PsaA protein of Streptococcus pneumoniae, and related methods and compositions. A peptide that comprises the amino acid sequence defined in SEQ ID NO:1 (an example of the P4 peptide) is provided. Also provided is a peptide comprising the amino acid sequence defined as VPSLFVDSSVDDRPMKTVSQDTNIPIYAQIFTDS (SEQ ID NO:2). P4 peptide mimetics having a conformational structure identical or similar to the conformation of P4 (e.g., SEQ ID NO: 1 and SEQ ID NO:2) are provided. An antibody that specifically binds to the epitope defined by the disclosed peptides is provided. For example, the antibody can specifically bind to a peptide comprising the sequence set forth in SEQ ID NO: 1 and having the conformation defined by the peptide consisting of SEQ ID NO: 1. An antibody that specifically binds to a peptide comprising the sequence set forth in SEQ ID NO:2 and having the conformation defined by the peptide consisting of SEQ ID NO:2 is also provided.
    Type: Application
    Filed: July 29, 2005
    Publication date: December 11, 2008
    Inventors: Edwin W. Ades, Jacquelyn S. Sampson, Sandra Steiner, George M. Carlone, Joseph J. Caba, GowriSankar Rajam
  • Publication number: 20080193966
    Abstract: This application discloses a multivalent opsonophagocytosis assay that does not rely on counting of bacterial colonies to determine bacteria viability following opsonophagocytosis. Instead, the method uses a metabolic colorimetric indicator to determine if viable bacteria are present. Also disclosed are arrays that can be used to determine the viability of bacteria following opsonophagocytosis.
    Type: Application
    Filed: April 21, 2006
    Publication date: August 14, 2008
    Inventors: Sandra Steiner, Patricia F. Holder, George M. Carlone, Gowrisankar Rajam
  • Publication number: 20060024234
    Abstract: Protein markers of toxicity and efficacy for antilipemic drugs are determined. Methods and reagents are disclosed for determining whether a patient receiving an antilipemic drug, especially a statin or HMGCoA reductase inhibiting drug, is experiencing drug efficacy and/or toxicity. Individual susceptibility is also determined prior to treatment. Also, drug discovery of similar acting candidates and their likelihood of being toxic or effective is determined by analysis of all proteins in a sample simultaneously by 2-dimensional gel electrophoresis.
    Type: Application
    Filed: September 19, 2005
    Publication date: February 2, 2006
    Applicant: LARGE SCALE PROTEOMICS CORPORATION, A Division of Large Scale Biology Corporation
    Inventors: N. Anderson, Sandra Steiner
  • Patent number: 6815172
    Abstract: Methods and compositions comprising immunoassays for the detection of functional antibodies and the analysis of vaccine efficacy are described. In particular, the present invention provides opsonophagocytic assays. The assays are useful for the rapid and simultaneous detection of multiple different functional antibodies. In preferred embodiments, the assays include fluorescent labels of multiple colors and/or intensities.
    Type: Grant
    Filed: December 7, 2001
    Date of Patent: November 9, 2004
    Assignees: The United States of America as represented by the Department of Health and Human Services, Flow Applications, Inc.
    Inventors: Joseph E. Martinez, George M. Carlone, Michael H. Hickey, Sandra Steiner
  • Publication number: 20020072492
    Abstract: Protein disease markers for obesity, osteoporosis, diabetes, osteoarthritis and hypertension are disclosed. These markers are not inherited or of genetic origin as they were not found in identical twins of the affected individual. Methods and uses for diagnostic, therapeutic and drug discovery are disclosed.
    Type: Application
    Filed: June 22, 2001
    Publication date: June 13, 2002
    Inventors: Timothy G. Myers, Rembert Pieper, John Taylor, Sandra Steiner, N. Leigh Anderson