Abstract: The present invention relates to a method of necrosing, causing membranolysis, or causing poration of selective cancer cells. In some aspects, the method includes administering a peptide including PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG (SEQ ID NO:48) or ETFSDLWKLLKKWKMRRNQFWVKVQRG (SEQ ID NO:49) to a selective cancer cell to cause necrosis, membranolysis, or poration of said selective cancer cell.

Abstract: A releasable restraint may comprise a base and a socket coupled to the base. The socket may include a head and a shaft extending from the head, wherein the shaft defines a base channel configured to receive the base. A sleeve may be configured to translate relative to the shaft of the socket. A plurality of balls may be located in a plurality of frustoconical ball openings formed through the shaft of the socket. A plug may be received by a plug channel defined by the socket.

Abstract: Stable, liquid formulations of anti-cancer peptides where the formulation contains about 1-75 mg/ml of anti-cancer peptides, about 5-30 mM acetate buffer, about 10-80 mg/ml mannitol, and about 0-30% sucrose, where the formulation has a pH of about 4.0-6.0, and wherein the anti-cancer peptides include an HDM-2 binding component and a membrane resident component.

Abstract: Disclosed are the methods and compositions for treating, ameliorating, or preventing COVID-19 or conditions associated with SARS-CoV-2 infection, and, also for reversing the damage caused by SARS-CoV-2 infection. Pharmaceutically acceptable compositions including spike protein binding partners, and optionally personal protective equipment included spike protein binding partners, are also disclosed.

Abstract: The invention provides an antibody or antibody fragment selective for HDM-2, an HDM-2 splice variant, or fragment thereof. The invention also provides a method of treating cancer, said method consisting of, consisting essentially of, or comprising administering to a subject in need thereof a therapeutic amount of an antibody or antibody fragment that is selective for membrane bound HDM-2, and any splice variants thereof.

Abstract: A releasable restraint may comprise a base and a socket coupled to the base. The socket may include a head and a shaft extending from the head. A sleeve may be configured to translate relative to the shaft of the socket. A plurality of balls may be located in the shaft of the socket. A plug may be received by a plug groove defined by the socket.

Abstract: The present invention relates to a method of necrosing, causing membranolysis, or causing poration of selective cancer cells. In some aspects, the method includes administering a peptide including PPLSQETFSDLWKLL-KKWKMRRN QFW VKV QRG or ETFSDLWKLL-KKWKMRRNQFWVKVQRG to a selective cancer cell to cause necrosis, membranolysis, or poration of said selective cancer cell.

Abstract: A siding tool for siding installation in building construction to efficiently measure the distance between adjacent siding panels and to install siding. The body of the siding tool is preferably approximately 3/16? ( 3/16 inches) wide, and a depth of approximately two inches (2?). The width and depth are used to measure distances according to building code. The body has a lip at one end that extends from the base of the body. The lip is configured to position the siding tool in place by catching the bottom edge of a panel of siding that has been placed. The lip of the siding tool is also configured for a user to position the siding tool upside down and use the lip to draw measurement lines.

Abstract: A golf tee tethering assembly for inhibiting a rubber mat tee from flying away during golf practice includes a rubber mat tee that is positionable on a rubber golfing mat to have a golf ball positioned thereon for striking. A washer is positioned around the rubber mat tee and a tether is coupled to the washer. A fastener is coupled to the tether on an opposite end of the tether from the ring. The fastener releasably engages a shaft of a golf club such that the rubber mat tee is retained on the golf club. The golf club is laid on the rubber golf mat and the rubber mat tee is positioned at a chosen spot on the rubber golf mat. Thus, the tether inhibits the rubber mat tee from flying away when the golf ball is struck from the rubber mat tee.

Abstract: A combined composite and metal hybrid component and a method of forming said component, are disclosed, the component comprising a substantially sheet-like or web-like body portion, made of a composite material, at least one stiffening member made of a metal and at least one made of a composite material, and curing the component in a vacuum bag, such that the metal stiffening member is formed against the composite stiffening member and the metal stiffening member remains a part of the hybrid composite component.

Abstract: The present disclosure provides an audio signal processing circuit for receiving an input signal derived from sound sensed by an acoustic sensor, the audio signal processing circuit comprising: a trigger phrase detection module for monitoring the input signal for at least one feature of a trigger phrase and outputting a trigger signal if one said feature is detected; wherein the trigger signal is ignored if a time interval between an occurrence of the at least one feature and an occurrence of a feature indicative of a start of speech contained in the input signal is greater than a threshold amount of time.

Abstract: An aspirator assembly for an inflatable device may have an inner housing disposed about an axis with an outlet formed through the inner housing. An outer housing may also be disposed about the axis with a surface of the outer housing covering the outlet. The outer housing may be translatable relative to the inner housing to expose the outlet in response to a gas pressure within the aspirator assembly being above a threshold.

Abstract: The present invention relates to structural component for an aircraft. The structural component comprises a body with a first surface and a lug that extends out of the first surface. The body and lug comprise a composite material and are integrally formed.

Abstract: An aircraft wing torsion box having a front associated with a leading portion of the wing torsion box and a rear associated with a trailing portion of the wing torsion box. The wing torsion box includes a support member having a front spar and a rear spar and a connecting portion between the front and rear spars, the connecting portion includes at least one interposing spar, at least one portion of upper wing skin; and at least one portion of lower wing skin, and at least one portion of the upper wing skin and at least one portion of the lower wing skin being supported by the support member.

Abstract: According to various embodiments, disclosed is a slide configured to be supported on a ground surface at a slide angle, comprising a support structure, a sliding surface supported by the support structure, and a weakened support region in the support structure, wherein the weakened support region enables the slide to buckle and the slide angle to change in response to a bending load imposed on the slide. According to various embodiments, the slide is an aircraft evacuation slide.

Abstract: An aspirator assembly for an inflatable device may have an inner housing disposed about an axis with an outlet formed through the inner housing. An outer housing may also be disposed about the axis with a surface of the outer housing covering the outlet. The outer housing may be translatable relative to the inner housing to expose the outlet in response to a gas pressure within the aspirator assembly being above a threshold.

Abstract: A structure having a panel, a stringer, and a rib is disclosed. The stringer includes a stringer flange that is joined to the panel and a stringer web that extends away from the stringer flange. The rib includes a rib web that has first and second faces and a rib foot that has a first rib foot flange that is joined to the stringer web, a second rib foot flange that is joined to the panel and a rib foot web that is joined to the first face of the rib web. The first rib foot flange is connected to the rib foot web by a first corner that includes at least one layer which runs continuously from the first rib foot flange into the rib foot web via the first corner. The second rib foot flange is connected to the rib foot web by a second corner that includes at least one layer which runs continuously from the second rib foot flange into the rib foot web via the second corner.

Abstract: An embodiment of an inflatable tube includes an elongated tube portion formed from a first fabric, the tube portion including at least one outer wall segment defining a cavity therein. A web is formed from a second fabric, and includes two or more edges secured to an interior surface of the at least one outer wall segment such that the web is disposed along a portion of a tube length.

Abstract: An intermediate reaction product to speed the reaction for producing capped MQ resins is disclosed. The intermediate reaction product includes an MQ-type silicone resin; a halosilane capping agent; and a polar organic compound. Optionally, a condensation catalyst and a solvent may be added to prepare the intermediate reaction product. Also, a method for preparing a reaction product to speed the reaction for producing capped MQ resins is disclosed. The method comprises the steps of combining ingredients comprising: an MQ-type silicone resin; a halosilane capping agent; and a polar organic compound. Optionally, a condensation catalyst and a solvent may be added to prepare the reaction product.

Abstract: A movement control strap for an off-wing evacuation system is disclosed. The strap is coupled between the ramp and slide, and engages with the edge of the wing. The strap stabilizes the evacuation system by providing a tensioning force to control movement of the ramp and slide. The strap assembly utilizes the edge of the wing as a leverage point for extra tensioning and control of the system.