Abstract: A system for quantifying viewer engagement with a video playing on a display includes at least one camera to acquire image data of a viewing area in front of the display. A microphone acquires audio data emitted by a speaker coupled to the display. The system also includes a memory to store processor-executable instructions and a processor. Upon execution of the processor-executable instructions, the processor receives the image data and the audio data and determines an identity of the video displayed on the display based on the audio data. The processor also estimates a first number of people present in the viewing area and a second number of people engaged with the video. The processor further quantifies the viewer engagement of the video based on the first number of people and the second number of people.

Abstract: The present application relates to inhibitors of VGSC?3 protein and use thereof and methods of using the VGSC?3 protein or an inhibitor thereof to diagnose, prevent and treat cancer, and to screen antineoplastic agents using the VGSC?3 Protein or its regulatory sequences.

Abstract: The disclosure discloses Bacillus subtilis for producing N-acetylneuraminic acid and application thereof, and belongs to the field of genetic engineering. The disclosure optimizes the expression levels of key enzymes in N-acetylneuraminic acid synthesis pathways on genome through promoters of different strength, reduces the protein synthesis pressure caused by the expression of enzymes on cells, and further integrates the three N-acetylneuraminic acids in a same Bacillus subtilis engineering strain. Bacillus subtilis with improved N-acetylneuraminic acid production is obtained, and the production reaches 10.4 g/L at the shake flask level, laying a foundation for further improving the NeuAc production from Bacillus subtilis.

Abstract: The present disclosure relates to a method for regulating expression of protein of interest in Bacillus subtilis, and belongs to the technical field of genetic engineering. The method comprises: using Bacillus subtilis as an expression host, adding the N-terminal nucleotide sequence coding the first 15 amino acids of the endogenous protein before the coding gene of the protein of interest or modifying the original N-terminal nucleotide sequence coding the first 15 amino acids, and performing free expression in plasmid, thereby regulating expression of the protein of interest in Bacillus subtilis, and even regulating the expression difference in different growth phases and the expression level.

Abstract: The present disclosure provides a plant fiber textile, a laminate with the plant fiber textile and a fabricating method of the laminate. The plant fiber textile has a matrix resin and continuous plant fibers distributed within the matrix resin. The plant fibers are subjected to a surface modification pretreatment including a coupling treatment with a coupling agent and/or a fire retardation treatment with a fire retardant. The laminate has a stack structure including a layer of the plant fiber textile and at least one layer selected from a group consisting of following layers: glass fiber, aramid fiber or carbon fiber non-woven cloth or textile, preferably distributed within the matrix resin; polymer fiber non-woven cloth or textile, preferably distributed within the matrix resin; or polymer foam or rubber material.

Abstract: Conventional television audience measurements are made with diaries or by imaging the area in front of a television and trying to identify the people in the images watching television. Unfortunately, diaries are only accurate if the audience members record entries in them, and image-based techniques are intrusive. The present techniques address these problems by using a viewer's wearable device to measure a viewer's proximity to a television. The wearable device emits or receives low-power beacon signals; measurements of the signal strength are used to calculate the viewer's distance to the television. If the viewer is close enough to the television and the television is on, the viewer may be engaged with the content on the television. This system is simple, non-intrusive, and can used to measure engagement with each television in a multi-television household.

Abstract: The present disclosure relates to a method for regulating expression of protein of interest in Bacillus subtilis, and belongs to the technical field of genetic engineering. The method comprises: using Bacillus subtilis as an expression host, adding the N-terminal nucleotide sequence coding the first 15 amino acids of the endogenous protein before the coding gene of the protein of interest or modifying the original N-terminal nucleotide sequence coding the first 15 amino acids, and performing free expression in plasmid, thereby regulating expression of the protein of interest in Bacillus subtilis, and even regulating the expression difference in different growth phases and the expression level.

Abstract: The present invention relates to a method for preparing a sulfur-resistant catalyst for aromatics saturated hydrogenation, comprising the steps of: preparing noble metal impregnation solutions from a noble metal and deionized water or an acid solution; impregnating a carrier with the impregnation solutions sequentially from high to low concentrations by incipient impregnation; homogenizing, drying, and calcinating to obtain the sulfur-resistant catalyst for aromatics saturated hydrogenation. The catalyst for aromatics saturated hydrogenation prepared by the method according to the present invention is primarily used in processing low-sulfur and high-aromatics light distillate, middle distillate, atmospheric gas oil, and vacuum gas oil.

Abstract: Disclosed are a method for preparing a noble metal hydrogenation catalyst comprising preparing a carrier from a molecular sieve having a 10-member ring structure and/or an amorphous porous material; preparing a noble metal impregnation solution; and preparing noble metal impregnation solutions in a concentration gradient ranging from 0.05 to 5.0 wt % with deionized water, and sequentially impregnating the carrier with the impregnation solutions from low to high concentrations during the carrier impregnation process, or preparing a noble metal impregnation solution at a low concentration ranging from 0.05 to 0.5 wt % and impregnating the carrier by gradually increasing the concentration of the noble metal impregnation solution to 2.0 to 5.0 wt % in the impregnation process, followed by homogenization, drying, and calcination, as well as a noble metal hydrogenation catalyst, use thereof, and a method for preparing lubricant base oil.

Abstract: The present invention provides a method for enhancing N-acetylglucosamine production by usage of a recombinant Bacillus subtilis with a glcK knockout. This invention enhanced the production of GlcNAc by knocking out the glcK gene which encodes a glucokinase, thus eliminating the GlcNAc phosphorylation to GlcNAc-6-P. The specific growth rate and content of GlcNAc in the supernatant of the recombinant Bacillus subtilis with the glcK knockout were 0.15 h?1 and 3.0 g/L, respectively, which were 2.32 times and 2.14 times of those of the control strain without glcK knockout. The recombinant Bacillus subtilis of the present invention would be potentially useful for industrial production of GlcNAc.

Abstract: A system for quantifying viewer engagement with a video playing on a display includes at least one camera to acquire image data of a viewing area in front of the display. A microphone acquires audio data emitted by a speaker coupled to the display. The system also includes a memory to store processor-executable instructions and a processor. Upon execution of the processor-executable instructions, the processor receives the image data and the audio data and determines an identity of the video displayed on the display based on the audio data. The processor also estimates a first number of people present in the viewing area and a second number of people engaged with the video. The processor further quantifies the viewer engagement of the video based on the first number of people and the second number of people.

Abstract: The present application relates to inhibitors of VGSC?3 protein and use thereof and methods of using the VGSC?3 protein or an inhibitor thereof to diagnose, prevent and treat cancer, and to screen antineoplastic agents using the VGSC?3 Protein or its regulatory sequences.

Abstract: The present invention provides a method for enhancing N-acetylglucosamine production by usage of a recombinant Bacillus subtilis with a glcK knockout. This invention enhanced the production of GlcNAc by knocking out the glcK gene which encodes a glucokinase, thus eliminating the GlcNAc phosphorylation to GlcNAc-6-P. The specific growth rate and content of GlcNAc in the supernatant of the recombinant Bacillus subtilis with the glcK knockout were 0.15 h?1 and 3.0 g/L, respectively, which were 2.32 times and 2.14 times of those of the control strain without glcK knockout. The recombinant Bacillus subtilis of the present invention would be potentially useful for industrial production of GlcNAc.

Abstract: The present invention relates to a method for preparing a sulfur-resistant catalyst for aromatics saturated hydrogenation, comprising the steps of: preparing noble metal impregnation solutions from a noble metal and deionized water or an acid solution; impregnating a carrier with the impregnation solutions sequentially from high to low concentrations by incipient impregnation; homogenizing, drying, and calcinating to obtain the sulfur-resistant catalyst for aromatics saturated hydrogenation. The catalyst for aromatics saturated hydrogenation prepared by the method according to the present invention is primarily used in processing low-sulfur and high-aromatics light distillate, middle distillate, atmospheric gas oil, and vacuum gas oil.

Abstract: Disclosed are a method for preparing a noble metal hydrogenation catalyst comprising preparing a carrier from a molecular sieve having a 10-member ring structure and/or an amorphous porous material; preparing a noble metal impregnation solution from one or more of compounds of noble metals Pt, Pd, Ru, Rh, Re, and Ir and deionized water or an acid solution; and preparing noble metal impregnation solutions in a concentration gradient ranging from 0.05 to 5.0 wt % with deionized water, and sequentially impregnating the carrier with the impregnation solutions from low to high concentrations during the carrier impregnation process, or preparing a noble metal impregnation solution at a low concentration ranging from 0.05 to 0.5 wt % and impregnating the carrier by gradually increasing the concentration of the noble metal impregnation solution to 2.0 to 5.

Abstract: The present invention provides an active peptide purified from scorpions, and derivatives, analogs and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below: VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.

Abstract: The present disclosure provides a plant fiber textile, a laminate with the plant fiber textile and a fabricating method of the laminate. The plant fiber textile has a matrix resin and continuous plant fibers distributed within the matrix resin. The plant fibers are subjected to a surface modification pretreatment including a coupling treatment with a coupling agent and/or a fire retardation treatment with a fire retardant. The laminate has a stack structure including a layer of the plant fiber textile and at least one layer selected from a group consisting of following layers: glass fiber, aramid fiber or carbon fiber non-woven cloth or textile, preferably distributed within the matrix resin; polymer fiber non-woven cloth or textile, preferably distributed within the matrix resin; or polymer foam or rubber material.

Abstract: The present invention relates to a method for producing lubricating base oil with a low cloud point and a high viscosity index. In the method, a lubricating base oil with a low pour point, a low cloud point and a high viscosity index is produced by a hydrorefining-isomerization/asymmetrical cracking-hydrofinishing in the presence of hydrogen, wherein a highly waxy heavy fraction oil having an initial boiling point of 300° C. to 460° C., a wax content of 5% or more, a pour point of ?20° C. or more and a cloud point of ?5° C. or more is used as a raw material, and naphtha and middle fraction oil being co-produced. The method is characterized mainly in the high yield of heavy base oil, a low pour point and cloud point, a high viscosity and viscosity index of the base oil.

Abstract: The present invention provides an active peptide purified from scorpions, and derivatives, analogues and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below: VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.

Abstract: The present invention relates to a peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof having analgesic and antitumor activity, and preparation method and use thereof. The peptide having analgesic and antitumor activity is obtained by extraction, isolation and purification from the scorpion or scorpion venom. The peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof can be obtained by chemical synthesis method or bioengineering method. The peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof is used as the analgesic and antitumor drugs.