Abstract: The present invention relates to a method for producing lubricating base oil with a low cloud point and a high viscosity index. In the method, a lubricating base oil with a low pour point, a low cloud point and a high viscosity index is produced by a hydrorefining-isomerization/asymmetrical cracking-hydrofinishing in the presence of hydrogen, wherein a highly waxy heavy fraction oil having an initial boiling point of 300° C. to 460° C., a wax content of 5% or more, a pour point of ?20° C. or more and a cloud point of ?5° C. or more is used as a raw material, and naphtha and middle fraction oil being co-produced. The method is characterized mainly in the high yield of heavy base oil, a low pour point and cloud point, a high viscosity and viscosity index of the base oil.

Abstract: The present invention provides an active peptide purified from scorpions, and derivatives, analogues and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below: VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.

Abstract: The present invention relates to a peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof having analgesic and antitumor activity, and preparation method and use thereof. The peptide having analgesic and antitumor activity is obtained by extraction, isolation and purification from the scorpion or scorpion venom. The peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof can be obtained by chemical synthesis method or bioengineering method. The peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof is used as the analgesic and antitumor drugs.

Abstract: The present invention relates to a peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof having analgesic and antitumor activity, and preparation method and use thereof. The peptide having analgesic and antitumor activity is obtained by extraction, isolation and purification from the scorpion or scorpion venom. The peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof can be obtained by chemical synthesis method or bioengineering method. The peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof is used as the analgesic and antitumor drugs.