Patents by Inventor Yanfeng Liu

Yanfeng Liu has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • ANALGESIC ACTIVE PEPTIDE VGG, PREPARATION AND USE THEREOF
    Publication number: 20130225500
    Abstract: The present invention provides an active peptide purified from scorpions, and derivatives, analogues and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below: VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.
    Type: Application
    Filed: July 5, 2011
    Publication date: August 29, 2013
    Applicant: SHENYANG PHARMACEUTICAL UNIVERSITY
    Inventors: Jianhai Zhang, Zhou Yang, Yanfeng Liu, Chunfu Wu
  • Method of using a peptide having analgesic and antitumor activity from scorpion
    Patent number: 7592309
    Abstract: The present invention relates to a peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof having analgesic and antitumor activity, and preparation method and use thereof. The peptide having analgesic and antitumor activity is obtained by extraction, isolation and purification from the scorpion or scorpion venom. The peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof can be obtained by chemical synthesis method or bioengineering method. The peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof is used as the analgesic and antitumor drugs.
    Type: Grant
    Filed: September 29, 2002
    Date of Patent: September 22, 2009
    Assignee: Shenyang Pharmaceutical University
    Inventors: Jinghai Zhang, Runlin Ma, Siling Wang, Yanfeng Liu, Chunfu Wu
  • Analgesic antitumor peptide from scorpion and method of producing it
    Publication number: 20060252676
    Abstract: The present invention relates to a peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof having analgesic and antitumor activity, and preparation method and use thereof. The peptide having analgesic and antitumor activity is obtained by extraction, isolation and purification from the scorpion or scorpion venom. The peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof can be obtained by chemical synthesis method or bioengineering method. The peptide having analgesic and antitumor activity derived from the scorpion and partial fragment, derivative or analogue thereof is used as the analgesic and antitumor drugs.
    Type: Application
    Filed: September 29, 2002
    Publication date: November 9, 2006
    Inventors: Jinghai Zhang, Runlin Ma, Siling Wang, Yanfeng Liu, Chunfu Wu