Abstract: A non-vanadium based metal oxide catalyst composition is provided. The catalyst composition comprises at least one metal oxide, comprising manganese oxide and being dispersed on the support, and a support comprising particles of composite oxide of aluminum and at least one metal selected from cerium, manganese and titanium, wherein aluminum is present in the composite oxide in an amount of from 50% to 80% by weight, calculated as Al2O3, based on the total weight of the composite oxide, and wherein manganese oxide is present in the metal oxide catalyst composition in an amount of from 2.5% to 10% by weight, calculated as MnO2, based on the total weight of the metal oxide catalyst composition.

Abstract: The present disclosure provides a magnetic transport line driving system, a magnetic transport line, and a control method for a magnetic transport line driving system, driving an actuating mechanism of a magnetic transport line according to an instruction, the actuating mechanism including multiple motor stators and at least one motor mover.

Abstract: The present disclosure provides catalyst compositions for NOx conversion and wall-flow filter substrates comprising such catalyst compositions. Certain catalyst compositions include a zeolite with sufficient Cu exchanged into cation sites thereof to give a Cu/Al ratio of 0.1 to 0.5 and a CuO loading of 1 to 15 wt. %; and a copper trapping component (e.g., alumina) including a plurality of particles having a D90 particle size of about 0.5 to 20 microns in a concentration of about 1 to 20 wt. %. The zeolite and copper trapping component can be in the same washcoat layer or can be in different washcoat layers (such that the copper trapping component serves as a “pre-coating” on the wall-flow filter substrate).

Abstract: Disclosed herein are emission treatment systems, articles, and methods for selectively reducing NOx compounds. The systems include a hydrogen generator, a hydrogen selective catalytic reduction (H2-SCR) article, and one or more of a diesel oxidation catalyst (DOC) and/or a lean NOx trap (LNT) and/or a low temperature NOx adsorber (LTNA). Certain articles may comprise a zone coated substrate and/or a layered coated substrate and/or an intermingled coated substrate of one or more of the H2-SCR and/or DOC and/or LNT and/or LTNA catalytic compositions.

Abstract: A selective catalytic reduction (SCR) catalyst composition effective in the abatement of nitrogen oxides (NOx) is provided. The SCR catalyst composition significantly increases the conversion of NOx relative to a Cu-chabazite reference catalyst composition at any temperature, and especially at low temperatures. A catalyst article, an exhaust gas treatment system, and a method of treating an exhaust gas stream, each including the SCR catalyst composition of the invention, are also provided. The SCR catalyst composition is particularly useful for treatment of exhaust from a lean-burn engine.

Abstract: A method of manufacturing a layered catalyst for purifying an exhaust gas stream includes introducing a mixture of colloidal ceria, alumina particles, and a liquid medium into a drying chamber via an atomizer to form atomized droplets of the mixture. A drying gas is introduced into the drying chamber such that the atomized droplets contact the drying gas, the liquid medium is removed from the atomized droplets, and ceria nanoparticles deposit on the alumina particles to form composite catalyst support particles. A catalyst precursor including a rhodium precursor and colloidal ceria is applied to the composite catalyst support particles. The composite catalyst support particles and the catalyst precursor are heated to form the layered catalyst. The layered catalyst includes an alumina substrate, a ceria nanoparticle layer extending substantially continuously over the alumina substrate, and a rhodium catalyst layer including an atomic dispersion of rhodium adsorbed on the ceria nanoparticle layer.

Abstract: Nanoparticles comprising a platinum group metal and a base metal, catalytic compositions comprising such nanoparticles and a support material, and methods of making such nanoparticles and catalytic compositions are disclosed. Catalytic articles and exhaust gas treatment systems, as well as methods of treating an exhaust gas stream comprising a pollutant using these catalytic articles and exhaust gas treatment systems, are also disclosed.

Abstract: A three-way catalyst for reduced palladium loading is provided. The catalyst includes an inert substrate and a palladium catalyst material coating the substrate. The palladium catalyst material includes a support material formed from one of 10% CeO2/Al2O3, 20% CeO2—Al2O3 (20CeAlOy), 30% CeO2—Al2O3 (30CeAlOy), Al2O3, and MOx-Al2O3, wherein M is one of copper, iron, manganese, titanium, zirconium, magnesium, strontium, and barium. The palladium catalyst material includes a layer of CeO2 material disposed upon the support material, wherein the layer of CeO2 material is dispersed on a surface of the support material. The palladium catalyst material includes an active component including a layer of praseodymium oxide particles dispersed across the surface of the layer of CeO2 material and a layer of palladium particles disposed upon and dispersed across the surface of the layer of CeO2 material at locations each corresponding to a respective location of each of the praseodymium particles.

Abstract: A three-way catalyst for reduced palladium loading is provided. The catalyst includes an inert substrate and a palladium catalyst material coating the substrate. The palladium catalyst material includes a support material formed from one of 10% CeO2/Al2O3, 20% CeO2—Al2O3 (20CeAlOy), 30% CeO2—Al2O3 (30CeAlOy), Al2O3, and MOx-Al2O3, wherein M is one of copper, iron, manganese, titanium, zirconium, magnesium, strontium, and barium. The palladium catalyst material includes a layer of CeO2 material disposed upon the support material, wherein the layer of CeO2 material is dispersed on a surface of the support material. The palladium catalyst material includes an active component including a layer of praseodymium oxide particles dispersed across the surface of the layer of CeO2 material and a layer of palladium particles disposed upon and dispersed across the surface of the layer of CeO2 material at locations each corresponding to a respective location of each of the praseodymium particles.

Abstract: Disclosed herein are emission treatment systems, articles, and methods for selectively reducing NOx compounds. The systems include a hydrogen generator, a hydrogen selective catalytic reduction (H2-SCR) article, and one or more of a diesel oxidation catalyst (DOC) and/or a lean NOx trap (LNT) and/or a low temperature NOx adsorber (LTNA). Certain articles may comprise a zone coated substrate and/or a layered coated substrate and/or an intermingled coated substrate of one or more of the H2-SCR and/or DOC and/or LNT and/or LTNA catalytic compositions.

Abstract: The present invention provides a catalyst composition comprising a) platinum; b) rhodium; and c) a ceria-alumina composite, a zirconia composite or a mixture thereof, wherein platinum is supported on the ceria-alumina composite, zirconia composite or mixture thereof, wherein rhodium is supported on the ceria-alumina composite, zirconia composite or mixture thereof, wherein CeO2 in the ceria alumina composite is 1.0 to 50 wt. %, based on the total weight of the ceria-alumina composite, wherein the amount of ZrO2 in the zirconia composite is 50 to 99 wt. %, based on the total weight of the zirconia composite. The present invention also provides a catalytic article comprising the catalyst composition and its preparation.

Abstract: Disclosed herein are emission treatment systems, articles, and methods for selectively reducing NOx compounds. The systems include a hydrogen generator, a hydrogen selective catalytic reduction (H2-SCR) article, and one or more of a diesel oxidation catalyst (DOC) and/or a lean NOx trap (LNT) and/or a low temperature NOx adsorber (LTNA). Certain articles may comprise a zone coated substrate and/or a layered coated substrate and/or an intermingled coated substrate of one or more of the H2-SCR and/or DOC and/or LNT and/or LTNA catalytic compositions.

Abstract: A nitrous oxide (N2O) removal catalyst composite is provided, comprising a N2O removal catalytic material on a substrate, the catalytic material comprising a rhodium (Rh) component supported on a ceria-based support, wherein the catalyst composite has a H2-consumption peak of about 100° C. or less as measured by hydrogen temperature-programmed reduction (H2-TPR). Methods of making and using the same are also provided.

Abstract: The present disclosure provides SCR catalyst compositions capable of reducing nitrogen oxide (NOx) emissions in engine exhaust. The catalyst compositions include a reducible metal oxide support containing ceria, one or more transition metal oxides as a redox promotor; and an oxide of niobium, tungsten, silicon, molybdenum, or a combination thereof as an acidic promotor. The redox promotor and the acid promotor are both supported on the reducible metal oxide support. Further provided are SCR catalyst articles coated with such compositions, processes for preparing such catalyst compositions and articles, an exhaust gas treatment system including such catalyst articles, and methods for reducing NOx in an exhaust gas stream using such catalyst articles and systems.

Abstract: Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X1 is selected from Y or F, and X2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.

Abstract: The present disclosure is directed to a system for treating an exhaust gas stream from an engine, which includes a diesel oxidation catalyst (DOC) located downstream of the engine and adapted for oxidation of hydrocarbons and carbon monoxide, an injector adapted for the addition of a reductant to the exhaust gas stream located downstream of the DOC, a catalyzed soot filter (CSF) located downstream of the injector, and a selective catalytic reduction component adapted for the oxidation of nitrogen oxides located downstream of the CSF. The CSF is adapted for oxidizing hydrocarbons and includes a selective oxidation catalyst composition on a filter with high selectivity ratio for hydrocarbon oxidation:ammonia oxidation (e.g., at least 0.6).

Abstract: The present disclosure is directed to a system for treating an exhaust gas stream from an engine, which includes a diesel oxidation catalyst (DOC) located downstream of the engine and adapted for oxidation of hydrocarbons and carbon monoxide, an injector adapted for the addition of a reductant to the exhaust gas stream located downstream of the DOC, a catalyzed soot filter (CSF) located downstream of the injector, and a selective catalytic reduction component adapted for the oxidation of nitrogen oxides located downstream of the CSF. The CSF is adapted for oxidizing hydrocarbons and includes a selective oxidation catalyst composition on a filter with high selectivity ratio for hydrocarbon oxidation:ammonia oxidation (e.g., at least 0.6).

Abstract: The invention relates to a selective ammonia oxidation catalysts comprising a platinum group metal and a support comprising TiO2 doped with 0-10% by weight of SiO2, WO3, ZrO2, Y2O3, La2O3, or a mixture thereof. The invention further comprises methods for the manufacture of the selective ammonia oxidation catalysts, and integrated catalyst systems comprising the selective ammonia oxidation catalysts for treating an exhaust gas stream.

Abstract: A nitrous oxide (N2O) removal catalyst composite is provided, comprising a N2O removal catalytic material on a substrate, the catalytic material comprising a rhodium (Rh) component supported on a ceria-based support, wherein the catalyst composite has a H2-consumption peak of about 100° C. or less as measured by hydrogen temperature-programmed reduction (H2-TPR). Methods of making and using the same are also provided.

Abstract: The present disclosure provides catalyst compositions for NOx conversion and wall-flow filter substrates comprising such catalyst compositions. Certain catalyst compositions include a zeolite with sufficient Cu exchanged into cation sites thereof to give a Cu/Al ratio of 0.1 to 0.5 and a CuO loading of 1 to 15 wt. %; and a copper trapping component (e.g., alumina) including a plurality of particles having a D90 particle size of about 0.5 to 20 microns in a concentration of about 1 to 20 wt. %. The zeolite and copper trapping component can be in the same washcoat layer or can be in different washcoat layers (such that the copper trapping component serves as a “pre-coating” on the wall-flow filter substrate).