Patents by Inventor Yuejin Li

Yuejin Li has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20250001402
    Abstract: A catalyst composition comprising a) platinum; and b) at least one composite, wherein platinum is supported on the composite, wherein the composite comprises: ceria (calculated as CeO2) in an amount of 5.0 to 50 wt. %, based on the total weight of the composite; alumina (calculated as Al2O3) in an amount of IO to 80 wt. %, based on the total weight of the composite; and magnesia (calculated as MgO) in an amount of to 80 wt. %, based on the total weight of the composite. The present invention also provides a process for the preparation of the catalyst composition. The present invention further provides a catalytic article and its preparation.
    Type: Application
    Filed: October 20, 2022
    Publication date: January 2, 2025
    Inventors: Fudong LIU, Shaohua XIE, Yuejin LI
  • Publication number: 20240424445
    Abstract: The present invention provides a catalytic article comprising a substrate: a bottom washcoat deposited on the substrate; and a top washcoat deposited on the bottom coat, wherein the bottom washcoat comprises a zoned configuration, wherein the zoned configuration comprises a first zone and a second zone, wherein the first zone comprises palladium supported on ceria-zirconia mixed oxide or alumina or both, wherein the second zone comprises platinum supported on a ceria-alumina composite, wherein the top washcoat comprises rhodium supported on an alumina or a ceria-alumina composite. The present invention also provides a process for the preparation of the catalytic article, and it use for purifying a gaseous exhaust stream.
    Type: Application
    Filed: September 8, 2022
    Publication date: December 26, 2024
    Inventors: Xiaolai ZHENG, Stephen JOHNSON, Yipeng SUN, Yuejin LI, Shiang SUNG, Chunxin JI, Pascaline TRAN, Pramod RAVINDRAN, Karifala DUMBUYA
  • Patent number: 12163454
    Abstract: The present disclosure provides catalyst compositions for NOx conversion and catalytic articles incorporating such catalyst compositions. Certain catalyst compositions include a zeolite with a silica-to-alumina ratio from 5 to 20 and sufficient Cu exchanged into cation sites of the zeolite such that the zeolite has a Cu/Al ratio of 0.1 to 0.5 and a CuO loading of 1 to 15 wt. %; and a copper trapping component in a concentration in the range of 1 to 20 wt. %, the copper trapping component including a plurality of particles having a particle size of about 0.5 to 20 microns. Certain catalyst compositions include, as the copper trapping component, alumina present as a plurality of alumina particles with a D90 particle size distribution in the range of 0.5 microns to 20 microns.
    Type: Grant
    Filed: October 24, 2019
    Date of Patent: December 10, 2024
    Assignee: BASF Mobile Emissions Catalysts LLC
    Inventors: Wen-Mei Xue, Ivan Petrovic, Jeff H. Yang, Stanley A. Roth, Yuejin Li
  • Publication number: 20240375086
    Abstract: A non-vanadium based metal oxide catalyst composition is provided. The catalyst composition comprises at least one metal oxide, comprising manganese oxide and being dispersed on the support, and a support comprising particles of composite oxide of aluminum and at least one metal selected from cerium, manganese and titanium, wherein aluminum is present in the composite oxide in an amount of from 50% to 80% by weight, calculated as Al2O3, based on the total weight of the composite oxide, and wherein manganese oxide is present in the metal oxide catalyst composition in an amount of from 2.5% to 10% by weight, calculated as MnO2, based on the total weight of the metal oxide catalyst composition.
    Type: Application
    Filed: August 18, 2022
    Publication date: November 14, 2024
    Inventors: Dengsong ZHANG, Penglu WANG, Hongrui LI, Yuejin LI, Shau Lin CHEN
  • Patent number: 12134088
    Abstract: The present disclosure provides catalyst compositions for NOx conversion and wall-flow filter substrates comprising such catalyst compositions. Certain catalyst compositions include a zeolite with sufficient Cu exchanged into cation sites thereof to give a Cu/Al ratio of 0.1 to 0.5 and a CuO loading of 1 to 15 wt. %; and a copper trapping component (e.g., alumina) including a plurality of particles having a D90 particle size of about 0.5 to 20 microns in a concentration of about 1 to 20 wt. %. The zeolite and copper trapping component can be in the same washcoat layer or can be in different washcoat layers (such that the copper trapping component serves as a “pre-coating” on the wall-flow filter substrate).
    Type: Grant
    Filed: October 24, 2019
    Date of Patent: November 5, 2024
    Assignee: BASF Mobile Emissions Catalysts LLC
    Inventor: Yuejin Li
  • Patent number: 12071882
    Abstract: Disclosed herein are emission treatment systems, articles, and methods for selectively reducing NOx compounds. The systems include a hydrogen generator, a hydrogen selective catalytic reduction (H2-SCR) article, and one or more of a diesel oxidation catalyst (DOC) and/or a lean NOx trap (LNT) and/or a low temperature NOx adsorber (LTNA). Certain articles may comprise a zone coated substrate and/or a layered coated substrate and/or an intermingled coated substrate of one or more of the H2-SCR and/or DOC and/or LNT and/or LTNA catalytic compositions.
    Type: Grant
    Filed: June 29, 2023
    Date of Patent: August 27, 2024
    Assignee: BASF Corporation
    Inventor: Yuejin Li
  • Patent number: 12053768
    Abstract: A selective catalytic reduction (SCR) catalyst composition effective in the abatement of nitrogen oxides (NOx) is provided. The SCR catalyst composition significantly increases the conversion of NOx relative to a Cu-chabazite reference catalyst composition at any temperature, and especially at low temperatures. A catalyst article, an exhaust gas treatment system, and a method of treating an exhaust gas stream, each including the SCR catalyst composition of the invention, are also provided. The SCR catalyst composition is particularly useful for treatment of exhaust from a lean-burn engine.
    Type: Grant
    Filed: July 30, 2019
    Date of Patent: August 6, 2024
    Assignee: BASF Corporation
    Inventor: Yuejin Li
  • Publication number: 20240253018
    Abstract: A method of manufacturing a layered catalyst for purifying an exhaust gas stream includes introducing a mixture of colloidal ceria, alumina particles, and a liquid medium into a drying chamber via an atomizer to form atomized droplets of the mixture. A drying gas is introduced into the drying chamber such that the atomized droplets contact the drying gas, the liquid medium is removed from the atomized droplets, and ceria nanoparticles deposit on the alumina particles to form composite catalyst support particles. A catalyst precursor including a rhodium precursor and colloidal ceria is applied to the composite catalyst support particles. The composite catalyst support particles and the catalyst precursor are heated to form the layered catalyst. The layered catalyst includes an alumina substrate, a ceria nanoparticle layer extending substantially continuously over the alumina substrate, and a rhodium catalyst layer including an atomic dispersion of rhodium adsorbed on the ceria nanoparticle layer.
    Type: Application
    Filed: January 30, 2023
    Publication date: August 1, 2024
    Inventors: Yuntao GU, Michelle H. WIEBENGA, Raneen TAHA, Yuejin LI, Xiaolai ZHENG
  • Publication number: 20240207826
    Abstract: Nanoparticles comprising a platinum group metal and a base metal, catalytic compositions comprising such nanoparticles and a support material, and methods of making such nanoparticles and catalytic compositions are disclosed. Catalytic articles and exhaust gas treatment systems, as well as methods of treating an exhaust gas stream comprising a pollutant using these catalytic articles and exhaust gas treatment systems, are also disclosed.
    Type: Application
    Filed: April 15, 2022
    Publication date: June 27, 2024
    Applicants: BASF Corporation, The Board of Trustees of the Leland Stanford Junior University
    Inventors: Matteo Cargenllo, An-Chih Yang, Nadia Tahsini, Yuejin Li
  • Patent number: 11801491
    Abstract: A three-way catalyst for reduced palladium loading is provided. The catalyst includes an inert substrate and a palladium catalyst material coating the substrate. The palladium catalyst material includes a support material formed from one of 10% CeO2/Al2O3, 20% CeO2—Al2O3 (20CeAlOy), 30% CeO2—Al2O3 (30CeAlOy), Al2O3, and MOx-Al2O3, wherein M is one of copper, iron, manganese, titanium, zirconium, magnesium, strontium, and barium. The palladium catalyst material includes a layer of CeO2 material disposed upon the support material, wherein the layer of CeO2 material is dispersed on a surface of the support material. The palladium catalyst material includes an active component including a layer of praseodymium oxide particles dispersed across the surface of the layer of CeO2 material and a layer of palladium particles disposed upon and dispersed across the surface of the layer of CeO2 material at locations each corresponding to a respective location of each of the praseodymium particles.
    Type: Grant
    Filed: April 21, 2022
    Date of Patent: October 31, 2023
    Assignees: GM GLOBAL TECHNOLOGY OPERATIONS LLC, University of Central Florida Research Foundation, Inc., BASF Corporation
    Inventors: Yuntao Gu, Fudong Liu, Wei Li, Shaohua Xie, Yuejin Li, Xiaolai Zheng
  • Publication number: 20230340898
    Abstract: Disclosed herein are emission treatment systems, articles, and methods for selectively reducing NOx compounds. The systems include a hydrogen generator, a hydrogen selective catalytic reduction (H2-SCR) article, and one or more of a diesel oxidation catalyst (DOC) and/or a lean NOx trap (LNT) and/or a low temperature NOx adsorber (LTNA). Certain articles may comprise a zone coated substrate and/or a layered coated substrate and/or an intermingled coated substrate of one or more of the H2-SCR and/or DOC and/or LNT and/or LTNA catalytic compositions.
    Type: Application
    Filed: June 29, 2023
    Publication date: October 26, 2023
    Inventor: Yuejin Li
  • Publication number: 20230338928
    Abstract: A three-way catalyst for reduced palladium loading is provided. The catalyst includes an inert substrate and a palladium catalyst material coating the substrate. The palladium catalyst material includes a support material formed from one of 10% CeO2/Al2O3, 20% CeO2—Al2O3 (20CeAlOy), 30% CeO2—Al2O3 (30CeAlOy), Al2O3, and MOx-Al2O3, wherein M is one of copper, iron, manganese, titanium, zirconium, magnesium, strontium, and barium. The palladium catalyst material includes a layer of CeO2 material disposed upon the support material, wherein the layer of CeO2 material is dispersed on a surface of the support material. The palladium catalyst material includes an active component including a layer of praseodymium oxide particles dispersed across the surface of the layer of CeO2 material and a layer of palladium particles disposed upon and dispersed across the surface of the layer of CeO2 material at locations each corresponding to a respective location of each of the praseodymium particles.
    Type: Application
    Filed: April 21, 2022
    Publication date: October 26, 2023
    Applicants: GM GLOBAL TECHNOLOGY OPERATIONS LLC, University of Central Florida, BASF Corporation
    Inventors: Yuntao Gu, Fudong Liu, Wei Li, Shaohua Xie, Yuejin Li, Xiaolai Zheng
  • Publication number: 20230321635
    Abstract: The present invention provides a catalyst composition comprising a) platinum; b) rhodium; and c) a ceria-alumina composite, a zirconia composite or a mixture thereof, wherein platinum is supported on the ceria-alumina composite, zirconia composite or mixture thereof, wherein rhodium is supported on the ceria-alumina composite, zirconia composite or mixture thereof, wherein CeO2 in the ceria alumina composite is 1.0 to 50 wt. %, based on the total weight of the ceria-alumina composite, wherein the amount of ZrO2 in the zirconia composite is 50 to 99 wt. %, based on the total weight of the zirconia composite. The present invention also provides a catalytic article comprising the catalyst composition and its preparation.
    Type: Application
    Filed: September 23, 2021
    Publication date: October 12, 2023
    Inventors: Yuejin Li, Andreas Sundermann, Xiaolai Zheng, Yipeng Sun, Karifala Dumbuya, Pascaline Tran
  • Patent number: 11732625
    Abstract: Disclosed herein are emission treatment systems, articles, and methods for selectively reducing NOx compounds. The systems include a hydrogen generator, a hydrogen selective catalytic reduction (H2-SCR) article, and one or more of a diesel oxidation catalyst (DOC) and/or a lean NOx trap (LNT) and/or a low temperature NOx adsorber (LTNA). Certain articles may comprise a zone coated substrate and/or a layered coated substrate and/or an intermingled coated substrate of one or more of the H2-SCR and/or DOC and/or LNT and/or LTNA catalytic compositions.
    Type: Grant
    Filed: April 17, 2019
    Date of Patent: August 22, 2023
    Assignee: BASF Corporation
    Inventor: Yuejin Li
  • Patent number: 11713705
    Abstract: A nitrous oxide (N2O) removal catalyst composite is provided, comprising a N2O removal catalytic material on a substrate, the catalytic material comprising a rhodium (Rh) component supported on a ceria-based support, wherein the catalyst composite has a H2-consumption peak of about 100° C. or less as measured by hydrogen temperature-programmed reduction (H2-TPR). Methods of making and using the same are also provided.
    Type: Grant
    Filed: September 23, 2021
    Date of Patent: August 1, 2023
    Assignee: BASF CORPORATION
    Inventors: Yuejin Li, Xiaolai Zheng, Stanley Roth, Olga Gerlach, Andreas Sundermann
  • Publication number: 20230219069
    Abstract: The present disclosure provides SCR catalyst compositions capable of reducing nitrogen oxide (NOx) emissions in engine exhaust. The catalyst compositions include a reducible metal oxide support containing ceria, one or more transition metal oxides as a redox promotor; and an oxide of niobium, tungsten, silicon, molybdenum, or a combination thereof as an acidic promotor. The redox promotor and the acid promotor are both supported on the reducible metal oxide support. Further provided are SCR catalyst articles coated with such compositions, processes for preparing such catalyst compositions and articles, an exhaust gas treatment system including such catalyst articles, and methods for reducing NOx in an exhaust gas stream using such catalyst articles and systems.
    Type: Application
    Filed: May 14, 2021
    Publication date: July 13, 2023
    Inventors: Fudong LIU, Yuejin LI, Shaohua XIE, Ge SONG
  • Publication number: 20230192865
    Abstract: Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X1 is selected from Y or F, and X2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.
    Type: Application
    Filed: May 6, 2020
    Publication date: June 22, 2023
    Inventors: Zhe SONG, Youlin QI, Yaobin QIN, Jianfeng YANG, Limin HOU, Zhiwei ZHU, Qiuping DONG, Xianggan LI, Lei ZHANG, Jinyu WANG, Yuejin LI
  • Publication number: 20230027701
    Abstract: The present disclosure is directed to a system for treating an exhaust gas stream from an engine, which includes a diesel oxidation catalyst (DOC) located downstream of the engine and adapted for oxidation of hydrocarbons and carbon monoxide, an injector adapted for the addition of a reductant to the exhaust gas stream located downstream of the DOC, a catalyzed soot filter (CSF) located downstream of the injector, and a selective catalytic reduction component adapted for the oxidation of nitrogen oxides located downstream of the CSF. The CSF is adapted for oxidizing hydrocarbons and includes a selective oxidation catalyst composition on a filter with high selectivity ratio for hydrocarbon oxidation:ammonia oxidation (e.g., at least 0.6).
    Type: Application
    Filed: September 26, 2022
    Publication date: January 26, 2023
    Applicant: BASF CORPORATION
    Inventors: Kevin Hallstrom, David Youngren, Yuejin Li
  • Patent number: 11486288
    Abstract: The present disclosure is directed to a system for treating an exhaust gas stream from an engine, which includes a diesel oxidation catalyst (DOC) located downstream of the engine and adapted for oxidation of hydrocarbons and carbon monoxide, an injector adapted for the addition of a reductant to the exhaust gas stream located downstream of the DOC, a catalyzed soot filter (CSF) located downstream of the injector, and a selective catalytic reduction component adapted for the oxidation of nitrogen oxides located downstream of the CSF. The CSF is adapted for oxidizing hydrocarbons and includes a selective oxidation catalyst composition on a filter with high selectivity ratio for hydrocarbon oxidation:ammonia oxidation (e.g., at least 0.6).
    Type: Grant
    Filed: May 8, 2020
    Date of Patent: November 1, 2022
    Assignee: BASF CORPORATION
    Inventors: Kevin Hallstrom, David Youngren, Yuejin Li
  • Publication number: 20220143579
    Abstract: The invention relates to a selective ammonia oxidation catalysts comprising a platinum group metal and a support comprising TiO2 doped with 0-10% by weight of SiO2, WO3, ZrO2, Y2O3, La2O3, or a mixture thereof. The invention further comprises methods for the manufacture of the selective ammonia oxidation catalysts, and integrated catalyst systems comprising the selective ammonia oxidation catalysts for treating an exhaust gas stream.
    Type: Application
    Filed: April 8, 2020
    Publication date: May 12, 2022
    Inventors: Yu Fen HAO, Yuejin LI, Stanley A. ROTH, Jan Martin BECKER, Stefan MAURER