Patents by Inventor Yuejin Li
Yuejin Li has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).
-
Patent number: 11801491Abstract: A three-way catalyst for reduced palladium loading is provided. The catalyst includes an inert substrate and a palladium catalyst material coating the substrate. The palladium catalyst material includes a support material formed from one of 10% CeO2/Al2O3, 20% CeO2—Al2O3 (20CeAlOy), 30% CeO2—Al2O3 (30CeAlOy), Al2O3, and MOx-Al2O3, wherein M is one of copper, iron, manganese, titanium, zirconium, magnesium, strontium, and barium. The palladium catalyst material includes a layer of CeO2 material disposed upon the support material, wherein the layer of CeO2 material is dispersed on a surface of the support material. The palladium catalyst material includes an active component including a layer of praseodymium oxide particles dispersed across the surface of the layer of CeO2 material and a layer of palladium particles disposed upon and dispersed across the surface of the layer of CeO2 material at locations each corresponding to a respective location of each of the praseodymium particles.Type: GrantFiled: April 21, 2022Date of Patent: October 31, 2023Assignees: GM GLOBAL TECHNOLOGY OPERATIONS LLC, University of Central Florida Research Foundation, Inc., BASF CorporationInventors: Yuntao Gu, Fudong Liu, Wei Li, Shaohua Xie, Yuejin Li, Xiaolai Zheng
-
Publication number: 20230340898Abstract: Disclosed herein are emission treatment systems, articles, and methods for selectively reducing NOx compounds. The systems include a hydrogen generator, a hydrogen selective catalytic reduction (H2-SCR) article, and one or more of a diesel oxidation catalyst (DOC) and/or a lean NOx trap (LNT) and/or a low temperature NOx adsorber (LTNA). Certain articles may comprise a zone coated substrate and/or a layered coated substrate and/or an intermingled coated substrate of one or more of the H2-SCR and/or DOC and/or LNT and/or LTNA catalytic compositions.Type: ApplicationFiled: June 29, 2023Publication date: October 26, 2023Inventor: Yuejin Li
-
Publication number: 20230338928Abstract: A three-way catalyst for reduced palladium loading is provided. The catalyst includes an inert substrate and a palladium catalyst material coating the substrate. The palladium catalyst material includes a support material formed from one of 10% CeO2/Al2O3, 20% CeO2—Al2O3 (20CeAlOy), 30% CeO2—Al2O3 (30CeAlOy), Al2O3, and MOx-Al2O3, wherein M is one of copper, iron, manganese, titanium, zirconium, magnesium, strontium, and barium. The palladium catalyst material includes a layer of CeO2 material disposed upon the support material, wherein the layer of CeO2 material is dispersed on a surface of the support material. The palladium catalyst material includes an active component including a layer of praseodymium oxide particles dispersed across the surface of the layer of CeO2 material and a layer of palladium particles disposed upon and dispersed across the surface of the layer of CeO2 material at locations each corresponding to a respective location of each of the praseodymium particles.Type: ApplicationFiled: April 21, 2022Publication date: October 26, 2023Applicants: GM GLOBAL TECHNOLOGY OPERATIONS LLC, University of Central Florida, BASF CorporationInventors: Yuntao Gu, Fudong Liu, Wei Li, Shaohua Xie, Yuejin Li, Xiaolai Zheng
-
Publication number: 20230321635Abstract: The present invention provides a catalyst composition comprising a) platinum; b) rhodium; and c) a ceria-alumina composite, a zirconia composite or a mixture thereof, wherein platinum is supported on the ceria-alumina composite, zirconia composite or mixture thereof, wherein rhodium is supported on the ceria-alumina composite, zirconia composite or mixture thereof, wherein CeO2 in the ceria alumina composite is 1.0 to 50 wt. %, based on the total weight of the ceria-alumina composite, wherein the amount of ZrO2 in the zirconia composite is 50 to 99 wt. %, based on the total weight of the zirconia composite. The present invention also provides a catalytic article comprising the catalyst composition and its preparation.Type: ApplicationFiled: September 23, 2021Publication date: October 12, 2023Inventors: Yuejin Li, Andreas Sundermann, Xiaolai Zheng, Yipeng Sun, Karifala Dumbuya, Pascaline Tran
-
Patent number: 11732625Abstract: Disclosed herein are emission treatment systems, articles, and methods for selectively reducing NOx compounds. The systems include a hydrogen generator, a hydrogen selective catalytic reduction (H2-SCR) article, and one or more of a diesel oxidation catalyst (DOC) and/or a lean NOx trap (LNT) and/or a low temperature NOx adsorber (LTNA). Certain articles may comprise a zone coated substrate and/or a layered coated substrate and/or an intermingled coated substrate of one or more of the H2-SCR and/or DOC and/or LNT and/or LTNA catalytic compositions.Type: GrantFiled: April 17, 2019Date of Patent: August 22, 2023Assignee: BASF CorporationInventor: Yuejin Li
-
Patent number: 11713705Abstract: A nitrous oxide (N2O) removal catalyst composite is provided, comprising a N2O removal catalytic material on a substrate, the catalytic material comprising a rhodium (Rh) component supported on a ceria-based support, wherein the catalyst composite has a H2-consumption peak of about 100° C. or less as measured by hydrogen temperature-programmed reduction (H2-TPR). Methods of making and using the same are also provided.Type: GrantFiled: September 23, 2021Date of Patent: August 1, 2023Assignee: BASF CORPORATIONInventors: Yuejin Li, Xiaolai Zheng, Stanley Roth, Olga Gerlach, Andreas Sundermann
-
Publication number: 20230219069Abstract: The present disclosure provides SCR catalyst compositions capable of reducing nitrogen oxide (NOx) emissions in engine exhaust. The catalyst compositions include a reducible metal oxide support containing ceria, one or more transition metal oxides as a redox promotor; and an oxide of niobium, tungsten, silicon, molybdenum, or a combination thereof as an acidic promotor. The redox promotor and the acid promotor are both supported on the reducible metal oxide support. Further provided are SCR catalyst articles coated with such compositions, processes for preparing such catalyst compositions and articles, an exhaust gas treatment system including such catalyst articles, and methods for reducing NOx in an exhaust gas stream using such catalyst articles and systems.Type: ApplicationFiled: May 14, 2021Publication date: July 13, 2023Inventors: Fudong LIU, Yuejin LI, Shaohua XIE, Ge SONG
-
Publication number: 20230192865Abstract: Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X1 is selected from Y or F, and X2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.Type: ApplicationFiled: May 6, 2020Publication date: June 22, 2023Inventors: Zhe SONG, Youlin QI, Yaobin QIN, Jianfeng YANG, Limin HOU, Zhiwei ZHU, Qiuping DONG, Xianggan LI, Lei ZHANG, Jinyu WANG, Yuejin LI
-
Publication number: 20230027701Abstract: The present disclosure is directed to a system for treating an exhaust gas stream from an engine, which includes a diesel oxidation catalyst (DOC) located downstream of the engine and adapted for oxidation of hydrocarbons and carbon monoxide, an injector adapted for the addition of a reductant to the exhaust gas stream located downstream of the DOC, a catalyzed soot filter (CSF) located downstream of the injector, and a selective catalytic reduction component adapted for the oxidation of nitrogen oxides located downstream of the CSF. The CSF is adapted for oxidizing hydrocarbons and includes a selective oxidation catalyst composition on a filter with high selectivity ratio for hydrocarbon oxidation:ammonia oxidation (e.g., at least 0.6).Type: ApplicationFiled: September 26, 2022Publication date: January 26, 2023Applicant: BASF CORPORATIONInventors: Kevin Hallstrom, David Youngren, Yuejin Li
-
Patent number: 11486288Abstract: The present disclosure is directed to a system for treating an exhaust gas stream from an engine, which includes a diesel oxidation catalyst (DOC) located downstream of the engine and adapted for oxidation of hydrocarbons and carbon monoxide, an injector adapted for the addition of a reductant to the exhaust gas stream located downstream of the DOC, a catalyzed soot filter (CSF) located downstream of the injector, and a selective catalytic reduction component adapted for the oxidation of nitrogen oxides located downstream of the CSF. The CSF is adapted for oxidizing hydrocarbons and includes a selective oxidation catalyst composition on a filter with high selectivity ratio for hydrocarbon oxidation:ammonia oxidation (e.g., at least 0.6).Type: GrantFiled: May 8, 2020Date of Patent: November 1, 2022Assignee: BASF CORPORATIONInventors: Kevin Hallstrom, David Youngren, Yuejin Li
-
Publication number: 20220143579Abstract: The invention relates to a selective ammonia oxidation catalysts comprising a platinum group metal and a support comprising TiO2 doped with 0-10% by weight of SiO2, WO3, ZrO2, Y2O3, La2O3, or a mixture thereof. The invention further comprises methods for the manufacture of the selective ammonia oxidation catalysts, and integrated catalyst systems comprising the selective ammonia oxidation catalysts for treating an exhaust gas stream.Type: ApplicationFiled: April 8, 2020Publication date: May 12, 2022Inventors: Yu Fen HAO, Yuejin LI, Stanley A. ROTH, Jan Martin BECKER, Stefan MAURER
-
Publication number: 20220010714Abstract: A nitrous oxide (N2O) removal catalyst composite is provided, comprising a N2O removal catalytic material on a substrate, the catalytic material comprising a rhodium (Rh) component supported on a ceria-based support, wherein the catalyst composite has a H2-consumption peak of about 100° C. or less as measured by hydrogen temperature-programmed reduction (H2-TPR). Methods of making and using the same are also provided.Type: ApplicationFiled: September 23, 2021Publication date: January 13, 2022Inventors: Yuejin Li, Xiaolai Zheng, Stanley Roth, Olga Gerlach, Andreas Sundermann
-
Publication number: 20220001371Abstract: The present disclosure provides catalyst compositions for NOx conversion and wall-flow filter substrates comprising such catalyst compositions. Certain catalyst compositions include a zeolite with sufficient Cu exchanged into cation sites thereof to give a Cu/Al ratio of 0.1 to 0.5 and a CuO loading of 1 to 15 wt. %; and a copper trapping component (e.g., alumina) including a plurality of particles having a D90 particle size of about 0.5 to 20 microns in a concentration of about 1 to 20 wt. %. The zeolite and copper trapping component can be in the same washcoat layer or can be in different washcoat layers (such that the copper trapping component serves as a “pre-coating” on the wall-flow filter substrate).Type: ApplicationFiled: October 24, 2019Publication date: January 6, 2022Applicant: BASF CorporationInventor: Yuejin LI
-
Publication number: 20210388747Abstract: The present disclosure provides catalyst compositions for NOx conversion and catalytic articles incorporating such catalyst compositions. Certain catalyst compositions include a zeolite with a silica-to-alumina ratio from 5 to 20 and sufficient Cu exchanged into cation sites of the zeolite such that the zeolite has a Cu/Al ratio of 0.1 to 0.5 and a CuO loading of 1 to 15 wt. %; and a copper trapping component in a concentration in the range of 1 to 20 wt. %, the copper trapping component including a plurality of particles having a particle size of about 0.5 to 20 microns. Certain catalyst compositions include, as the copper trapping component, alumina present as a plurality of alumina particles with a D90 particle size distribution in the range of 0.5 microns to 20 microns.Type: ApplicationFiled: October 24, 2019Publication date: December 16, 2021Applicant: BASF CorporationInventors: Wen-Mei XUE, Ivan PETROVIC, Jeff H. YANG, Stanley A. ROTH, Yuejin LI
-
Patent number: 11149610Abstract: A nitrous oxide (N2O) removal catalyst composite is provided, comprising a N2O removal catalytic material on a substrate, the catalytic material comprising a rhodium (Rh) component supported on a ceria-based support, wherein the catalyst composite has a H2-consumption peak of about 100° C. or less as measured by hydrogen temperature-programmed reduction (H2-TPR). Methods of making and using the same are also provided.Type: GrantFiled: April 2, 2020Date of Patent: October 19, 2021Assignee: BASF CorporationInventors: Yuejin Li, Xiaolai Zheng, Stanley Roth, Olga Gerlach, Andreas Sundermann
-
Patent number: 11117098Abstract: Provided are multi-zone catalyst articles, methods of manufacturing multi-zone catalyst articles, and methods for controlling emissions in diesel engine exhaust streams with multi-zone catalyst articles, where the emission treatment system of various embodiments effectively treats diesel engine exhaust with a single multi-zone catalyst article.Type: GrantFiled: March 30, 2016Date of Patent: September 14, 2021Assignee: BASF CorporationInventors: Yuejin Li, Stanley A. Roth
-
Publication number: 20210178380Abstract: A selective catalytic reduction (SCR) catalyst composition effective in the abatement of nitrogen oxides (NOx) is provided. The SCR catalyst composition significantly increases the conversion of NOx relative to a Cu-chabazite reference catalyst composition at any temperature, and especially at low temperatures. A catalyst article, an exhaust gas treatment system, and a method of treating an exhaust gas stream, each including the SCR catalyst composition of the invention, are also provided. The SCR catalyst composition is particularly useful for treatment of exhaust from a lean-burn engine.Type: ApplicationFiled: July 30, 2019Publication date: June 17, 2021Applicant: BASF CORPORATIONInventor: Yuejin Li
-
Publication number: 20210114007Abstract: The present disclosure generally provides selective catalytic reduction (SCR) catalyst compositions, catalyst articles and catalyst systems including such catalyst articles for treating engine exhaust gas. In particular, the SCR catalyst composition includes a first zeolite and a second zeolite and has not been subjected to temperatures above 650° C. The first zeolite includes a promoter metal and has a first framework structure and at least a portion of the second zeolite is in a form selected from H+ form, NH4+ form, alkali metal form, alkaline earth metal form, and combinations thereof and has a second framework structure. The first framework structure and the second framework structure are different.Type: ApplicationFiled: April 10, 2019Publication date: April 22, 2021Applicant: BASF CorporationInventor: Yuejin LI
-
Patent number: 10961890Abstract: An on-board vehicle reservoir containing an ammonia/organic solvent solution may be associated with a phase separator configured to isolate ammonia from the solution. The ammonia may be introduced into an exhaust gas stream of an internal combustion engine to function as a catalytic reductant. Ammonia may be employed to generate hydrogen via catalytic decomposition of ammonia, and the hydrogen may be introduced into an exhaust gas stream to aid catalytic reactions such as catalytic oxidation of carbon monoxide (CO) and/or hydrocarbon (HC) and/or reduction of nitrogen oxides (NO); for instance during a cold-start period.Type: GrantFiled: October 2, 2019Date of Patent: March 30, 2021Assignee: BASF CorporationInventors: Shiang Sung, Michael Locascio, Yuejin Li
-
Patent number: 10919025Abstract: A nitrous oxide (N2O) removal catalyst composition for treating an exhaust stream of an internal combustion engine is provided, containing a platinum group metal (PGM) component on a metal oxide-based support, wherein the N2O removal catalyst composition is in a substantially reduced form, such that it has an oxygen deficiency of about 0.05 mmol oxygen atoms/g or greater, and wherein the N2O removal catalyst composition provides effective removal of at least a portion of N2O from the exhaust stream under lean conditions at a temperature of about 350° C. or lower. N2O removal catalytic articles, systems, and methods are also provided for removing at least a portion of N2O from an exhaust stream under lean, low temperature conditions.Type: GrantFiled: January 24, 2020Date of Patent: February 16, 2021Assignee: BASF CorporationInventors: Yuejin Li, Shiang Sung, Stanley D. Roth, Torsten Neubauer, Susanne Stiebels