Patents by Inventor Zhen Lin

Zhen Lin has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20250246672
    Abstract: This application relates to the technical field of lithium-ion batteries, in particular to a lithium-ion battery electrolyte solution, a secondary battery, a battery module, a battery pack, and an electrical device. The lithium-ion battery electrolyte solution includes a lithium salt, an organic solvent and an additive. The additive includes a compound represented by Formula I: where R1 to R4 are each independently selected from a hydrogen atom, a halogen atom, a nitrate ester group, a nitrite ester group, a substituted or unsubstituted C1 to C12 alkyl, and a substituted or unsubstituted C1 to C12 alkoxy, provided that at least one of R1 to R4 is a nitrate ester group. This application solves the problems of poor solubility of existing additives and low conductivity of a formed solid electrolyte interphase (SEI).
    Type: Application
    Filed: April 18, 2025
    Publication date: July 31, 2025
    Inventors: Xinfeng Yang, Meina Lei, Zhishan Chen, Zhen Lin, Wei Li, Kai Wu
  • Patent number: 12367152
    Abstract: In certain embodiments, a computer-implemented method includes: receiving, by a caching system plugin, a request to create a persistent volume for a container application instance; configuring, by the caching system plugin, a local cache volume on a host computing device; configuring, by the caching system plugin, a remote storage volume on a remote storage device; selecting, by a policy manager of the caching system plugin, a cache policy for the container application instance; creating, by the caching system plugin and from a cache manager, a virtual block device associated with the local cache volume, the remote storage volume, and the cache policy; and providing the virtual block device for use by the container application instance as the persistent volume.
    Type: Grant
    Filed: September 29, 2023
    Date of Patent: July 22, 2025
    Assignee: Hewlett Packard Enterprise Development LP
    Inventors: Lianjie Cao, Zhen Lin, Faraz Ahmed, Puneet Sharma
  • Patent number: 12346921
    Abstract: Systems and methods for dynamic demand sensing in a supply chain in which constantly-updated data is used to select a machine learning model or retrain a pre-selected machine learning model, for forecasting sales of a product at a specific location. The updated data includes product information and geographic information. Also disclosed are systems and methods relating to demand forecasting and readjusting forecasts based on forecast error.
    Type: Grant
    Filed: August 25, 2023
    Date of Patent: July 1, 2025
    Inventors: Ali Khanafer, Behrouz Haji Soleimani, Sebastien Ouellet, Christopher Wang, Chantal Bisson-Krol, Zhen Lin
  • Publication number: 20250140778
    Abstract: This application provides a positive electrode plate and a preparation method thereof, an electrode assembly, a battery cell, and a battery and pertains to the field of battery technologies. The method for preparing a positive electrode plate includes: providing an adhesive liquid on at least one surface of at least partial to-be-bent position of a positive electrode current collector and curing it to form an adhesive layer, and forming a positive electrode active material layer on at least one surface of the positive electrode current collector having the adhesive layer. The adhesive liquid is first provided on at least one surface of the to-be-bent position of the positive electrode current collector and cured to form the adhesive layer, and then the positive electrode active material layer is formed.
    Type: Application
    Filed: January 3, 2025
    Publication date: May 1, 2025
    Inventors: Shiliang Lin, Lan Xie, Zhen Lin, Wei Li, Xiaohui Wu
  • Publication number: 20250115541
    Abstract: The disclosure relates to the technical filed of organic synthesis, in particular to a method for preparing veratrole. In the disclosure, veratrole is prepared by using lithium hydroxide instead of sodium hydroxide, catechol as raw material, and dimethyl sulfate as methylating agent. Comparing with the existing method of adding sodium hydroxide solution, the method according to the disclosure allows reduced reaction temperature, shortened reaction time, and thereby improves the stability and safety of the reaction and the product yield. The experimental data of the examples in the disclosure shows a veratrole yield up to 95%. Furthermore, the preparation method according to the disclosure does not need to be carried out under a reflux condition, the operation of which is simpler, thereby further improving the safety and stability of the reaction.
    Type: Application
    Filed: December 20, 2022
    Publication date: April 10, 2025
    Applicant: SHANDONG HOLLY PHARMACEUTICAL CO., LTD.
    Inventors: Huaqiang Wu, Lanhua Li, Yuenan Qiu, Zhiyuan Liu, Hongyuan Zhang, Lijun Jiang, Zhen Lin, Shuqiang Gai, Kuankuan Sun
  • Patent number: 12271920
    Abstract: Systems and methods for features engineering, in which internal and external signals are received and fused. The fusing is based on meta-data of each of the one or more internal signals and each of the one or more external signals. A set of features is generated based on one or more valid combinations that match a transformation input, the transformation forming part of library of transformations. Finally, a set of one or more features is selected from the plurality of features, based on a predictive strength of each feature. The set of selected features can be used to train and select a machine learning model.
    Type: Grant
    Filed: November 24, 2022
    Date of Patent: April 8, 2025
    Assignee: Kinaxis Inc.
    Inventors: Sebastien Ouellet, Zhen Lin, Christopher Wang, Chantal Bisson-Krol
  • Publication number: 20250110883
    Abstract: In certain embodiments, a computer-implemented method includes: receiving, by a caching system plugin, a request to create a persistent volume for a container application instance; configuring, by the caching system plugin, a local cache volume on a host computing device; configuring, by the caching system plugin, a remote storage volume on a remote storage device; selecting, by a policy manager of the caching system plugin, a cache policy for the container application instance; creating, by the caching system plugin and from a cache manager, a virtual block device associated with the local cache volume, the remote storage volume, and the cache policy; and providing the virtual block device for use by the container application instance as the persistent volume.
    Type: Application
    Filed: September 29, 2023
    Publication date: April 3, 2025
    Inventors: Lianjie Cao, Zhen Lin, Faraz Ahmed, Puneet Sharma
  • Patent number: 12255485
    Abstract: A charging method for a battery pack includes sending, by a battery management module of the battery pack, a charging request for a first current to a charging pile for charging, controlling, by the battery management module in response to determining that first-current charging of the battery pack meets a first predetermined condition, the battery pack to perform pulse discharge, and controlling, by the battery management module in response to determining that the pulse discharge of the battery pack meets a second predetermined condition, the battery pack to stop discharging, and sending a charging request for a second current to the charging pile for charging. The second current is less than the first current.
    Type: Grant
    Filed: August 24, 2023
    Date of Patent: March 18, 2025
    Assignee: CONTEMPORARY AMPEREX TECHNOLOGY (HONG KONG) LIMITED
    Inventors: Lan Xie, Zhen Lin, Shan Huang, Wei Li, Shichao Li
  • Patent number: 12242954
    Abstract: A computer-implemented method of interactive machine learning in which a user is provided with predicted results from a trained machine learning model. The user can take the predicted results and adjust the predicted data to retrain the model.
    Type: Grant
    Filed: November 28, 2019
    Date of Patent: March 4, 2025
    Assignee: Kinaxis Inc.
    Inventors: Chantal Bisson-Krol, Zhen Lin, Ishan Amlekar, Kevin Shen, Seyednaser Nourashrafeddin, Sebastien Ouellet
  • Patent number: 12226988
    Abstract: A sticking machine able to automatically remove films on either side of a sheet to be pasted to a workpiece includes a sheet supply component, a sheet selection component, a drive component, a first film-removing component, a second film-removing component, a carrier, and a transmission line. The sheet supply component stores sheets. The sheet selection component applies suction to the sheet. The first film-removing component tears off a first film, the second film-removing component tears off a second film on the reverse side. The transmission line carries the workpiece to the carrier. The sticking machine is fed by the sheet supply component, and after removal of the first film, the sheet selection component lays the sheet on the surface of the workpiece, then the second film-removing component tears off the second film, realizing automatic sticking of the sheet on the workpiece, improving the processing efficiency and accuracy.
    Type: Grant
    Filed: October 30, 2020
    Date of Patent: February 18, 2025
    Assignees: FU DING ELECTRONICAL TECHNOLOGY (JIASHAN) CO., LTD., FUZHUN PRECISION TOOLING (JIASHAN) CO., LTD.
    Inventors: Zhen-Lin Zhao, Min Liu, Wen-Jin Xia, Wei-Wei Wu, Wei-Ping Li, Huo-Zhong Wu
  • Patent number: 12187770
    Abstract: A cyclic peptide from a bone morphogenetic protein 2 (BrvIP2). The cyclic peptide from the novel BMP2 is selected from one of the following cyclic polypeptides: 1. a cyclic polypeptide having the sequence of CKIPKASSVPTELSAISMLYLGPGGDWIVAC (SEQ ID NO:1); and 2. a cyclic polypeptide of which the sequence has an 80% homology with the sequence defined in item 1. A preparation method for the cyclic peptide from the novel Blv1P2, and an application thereof in the preparation of the composite material for promoting the repair of large-sized bone defects.
    Type: Grant
    Filed: April 15, 2021
    Date of Patent: January 7, 2025
    Assignee: HANGZHOU HUIBO SCIENCE AND TECHNOLOGY CO., LTD
    Inventors: Yi Liu, Zhen Lin, Gang Wu
  • Patent number: 12154013
    Abstract: A computer-implemented method of interactive machine learning in which a user is provided with predicted results from a trained machine learning model. The user can take the predicted results and either: i) adjust the predicted results and input the adjusted results as new data; or ii) adjust the predicted data to retrain the model.
    Type: Grant
    Filed: November 27, 2019
    Date of Patent: November 26, 2024
    Assignee: Kinaxis Inc.
    Inventors: Chantal Bisson-Krol, Zhen Lin, Ishan Amlekar, Kevin Shen, Seyednaser Nourashrafeddin, Sebastien Ouellet
  • Publication number: 20240377405
    Abstract: The disclosure provides methods of analyzing an analyte of interest in a biological sample using fluorescent agents and macroconjugates which comprise a core containing a cross-linked polymer or protein, tags, specific binding members or fragments thereof, and optionally carrier proteins. Also provided are methods of analyzing two or more analytes of interest in a biological sample in a single assay using microparticles and detection conjugates comprising different fluorophore labels, acquiring transmitted light and fluorescent images of the microparticles, and using a customized image analysis process to analyze the acquired images.
    Type: Application
    Filed: July 2, 2024
    Publication date: November 14, 2024
    Inventors: Qiaoqiao Ruan, Patrick J. Macdonald, Kerry M. Swift, Sergey Y. Tetin, Brenda Calfin, Zhen Lin, Richard Haack, Mark R. Pope, John Prostko, Xiaoxing Qiu, M. Felicia Bogdan
  • Patent number: 12141690
    Abstract: A computer-implemented method of interactive machine learning in which a user is provided with predicted results from a trained machine learning model. The user can take the predicted results and adjust the predicted data to retrain the model.
    Type: Grant
    Filed: November 28, 2019
    Date of Patent: November 12, 2024
    Assignee: Kinaxis Inc.
    Inventors: Chantal Bisson-Krol, Zhen Lin, Ishan Amlekar, Kevin Shen, Seyednaser Nourashrafeddin, Sebastien Ouellet
  • Publication number: 20240370723
    Abstract: A computer-implemented method of interactive machine learning in which a user is provided with predicted results from a trained machine learning model. The user can take the predicted results and adjust the predicted data to retrain the model.
    Type: Application
    Filed: June 25, 2024
    Publication date: November 7, 2024
    Inventors: Chantal BISSON-KROL, Zhen LIN, Ishan AMLEKAR, Kevin SHEN, Seyednaser NOURASHRAFEDDIN, Sebastien OUELLET
  • Publication number: 20240291056
    Abstract: An electrode assembly short circuit identification method includes: during charging, according to preset sampling time points, sequentially acquiring a voltage of an electrode assembly at each of the sampling time points; judging whether the electrode assembly has a continuous voltage drop according to the voltage acquired at each of the sampling time points; and determining whether the electrode assembly has a short circuit according to a judgment result.
    Type: Application
    Filed: May 6, 2024
    Publication date: August 29, 2024
    Inventors: Lan XIE, Shiliang LIN, Zhen LIN, Shuai SONG, Wei LI, Zhonghong LI, Kai WU
  • Publication number: 20240283034
    Abstract: This application relates to a liquid leak detection method and apparatus, a battery control unit, and a battery management system. The method includes: obtaining a gas concentration detection signal output separately by a plurality of target gas sensors in a battery box, where the gas concentration detection signal is used for indicating a measured gas concentration; obtaining position information of each target gas sensor in the battery box; and determining a leaking region in the battery box based on the gas concentration detection signal and the position information of each target gas sensor. To sum up, in an embodiment of this application, the leaking region in the battery box can be located by analyzing the gas concentration detection signals and position information of a plurality of target gas sensors in the battery box, so that prompt information used for indicating the leaking region can be output subsequently.
    Type: Application
    Filed: April 29, 2024
    Publication date: August 22, 2024
    Applicant: CONTEMPORARY AMPEREX TECHNOLOGY CO., LIMITED
    Inventors: Long SUN, Lan XIE, Chenping WANG, Xiaohui WU, Zhen LIN
  • Publication number: 20240282973
    Abstract: A positive electrode sheet has a straight portion and to-be-bent portions, A thickening layer is disposed on at least one side of a positive electrode current collector of at least some of the to-be-bent portions, the thickening layer is disposed between the positive electrode current collector and a positive electrode active material layer, the positive electrode active material layer covers a surface of the thickening layer is a first positive electrode active material layer, and the positive electrode active material layer located in the straight portion is a second positive electrode active material layer. A ratio of a thickness of the first positive electrode active material layer to a thickness of the second positive electrode active material layer is 20-80%.
    Type: Application
    Filed: April 17, 2024
    Publication date: August 22, 2024
    Inventors: Lan XIE, Zhen LIN, Shiliang LIN, Xiaohui WU, Long WANG, Wei LI, Zhonghong LI, Kai WU
  • Patent number: D1062794
    Type: Grant
    Filed: August 1, 2022
    Date of Patent: February 18, 2025
    Assignee: FUJIAN AIDI ELECTRIC CO., LTD.
    Inventor: Xi Zhen Lin
  • Patent number: D1070177
    Type: Grant
    Filed: August 21, 2024
    Date of Patent: April 8, 2025
    Inventor: Zhen Lin