Abstract: This application relates to the technical field of lithium-ion batteries, in particular to a lithium-ion battery electrolyte solution, a secondary battery, a battery module, a battery pack, and an electrical device. The lithium-ion battery electrolyte solution includes a lithium salt, an organic solvent and an additive. The additive includes a compound represented by Formula I: where R1 to R4 are each independently selected from a hydrogen atom, a halogen atom, a nitrate ester group, a nitrite ester group, a substituted or unsubstituted C1 to C12 alkyl, and a substituted or unsubstituted C1 to C12 alkoxy, provided that at least one of R1 to R4 is a nitrate ester group. This application solves the problems of poor solubility of existing additives and low conductivity of a formed solid electrolyte interphase (SEI).

Abstract: In certain embodiments, a computer-implemented method includes: receiving, by a caching system plugin, a request to create a persistent volume for a container application instance; configuring, by the caching system plugin, a local cache volume on a host computing device; configuring, by the caching system plugin, a remote storage volume on a remote storage device; selecting, by a policy manager of the caching system plugin, a cache policy for the container application instance; creating, by the caching system plugin and from a cache manager, a virtual block device associated with the local cache volume, the remote storage volume, and the cache policy; and providing the virtual block device for use by the container application instance as the persistent volume.

Abstract: This application provides a positive electrode plate and a preparation method thereof, an electrode assembly, a battery cell, and a battery and pertains to the field of battery technologies. The method for preparing a positive electrode plate includes: providing an adhesive liquid on at least one surface of at least partial to-be-bent position of a positive electrode current collector and curing it to form an adhesive layer, and forming a positive electrode active material layer on at least one surface of the positive electrode current collector having the adhesive layer. The adhesive liquid is first provided on at least one surface of the to-be-bent position of the positive electrode current collector and cured to form the adhesive layer, and then the positive electrode active material layer is formed.

Abstract: The disclosure relates to the technical filed of organic synthesis, in particular to a method for preparing veratrole. In the disclosure, veratrole is prepared by using lithium hydroxide instead of sodium hydroxide, catechol as raw material, and dimethyl sulfate as methylating agent. Comparing with the existing method of adding sodium hydroxide solution, the method according to the disclosure allows reduced reaction temperature, shortened reaction time, and thereby improves the stability and safety of the reaction and the product yield. The experimental data of the examples in the disclosure shows a veratrole yield up to 95%. Furthermore, the preparation method according to the disclosure does not need to be carried out under a reflux condition, the operation of which is simpler, thereby further improving the safety and stability of the reaction.

Abstract: Systems and methods for features engineering, in which internal and external signals are received and fused. The fusing is based on meta-data of each of the one or more internal signals and each of the one or more external signals. A set of features is generated based on one or more valid combinations that match a transformation input, the transformation forming part of library of transformations. Finally, a set of one or more features is selected from the plurality of features, based on a predictive strength of each feature. The set of selected features can be used to train and select a machine learning model.

Abstract: In certain embodiments, a computer-implemented method includes: receiving, by a caching system plugin, a request to create a persistent volume for a container application instance; configuring, by the caching system plugin, a local cache volume on a host computing device; configuring, by the caching system plugin, a remote storage volume on a remote storage device; selecting, by a policy manager of the caching system plugin, a cache policy for the container application instance; creating, by the caching system plugin and from a cache manager, a virtual block device associated with the local cache volume, the remote storage volume, and the cache policy; and providing the virtual block device for use by the container application instance as the persistent volume.

Abstract: A charging method for a battery pack includes sending, by a battery management module of the battery pack, a charging request for a first current to a charging pile for charging, controlling, by the battery management module in response to determining that first-current charging of the battery pack meets a first predetermined condition, the battery pack to perform pulse discharge, and controlling, by the battery management module in response to determining that the pulse discharge of the battery pack meets a second predetermined condition, the battery pack to stop discharging, and sending a charging request for a second current to the charging pile for charging. The second current is less than the first current.

Abstract: A computer-implemented method of interactive machine learning in which a user is provided with predicted results from a trained machine learning model. The user can take the predicted results and adjust the predicted data to retrain the model.

Abstract: A sticking machine able to automatically remove films on either side of a sheet to be pasted to a workpiece includes a sheet supply component, a sheet selection component, a drive component, a first film-removing component, a second film-removing component, a carrier, and a transmission line. The sheet supply component stores sheets. The sheet selection component applies suction to the sheet. The first film-removing component tears off a first film, the second film-removing component tears off a second film on the reverse side. The transmission line carries the workpiece to the carrier. The sticking machine is fed by the sheet supply component, and after removal of the first film, the sheet selection component lays the sheet on the surface of the workpiece, then the second film-removing component tears off the second film, realizing automatic sticking of the sheet on the workpiece, improving the processing efficiency and accuracy.

Abstract: A cyclic peptide from a bone morphogenetic protein 2 (BrvIP2). The cyclic peptide from the novel BMP2 is selected from one of the following cyclic polypeptides: 1. a cyclic polypeptide having the sequence of CKIPKASSVPTELSAISMLYLGPGGDWIVAC (SEQ ID NO:1); and 2. a cyclic polypeptide of which the sequence has an 80% homology with the sequence defined in item 1. A preparation method for the cyclic peptide from the novel Blv1P2, and an application thereof in the preparation of the composite material for promoting the repair of large-sized bone defects.

Abstract: A computer-implemented method of interactive machine learning in which a user is provided with predicted results from a trained machine learning model. The user can take the predicted results and either: i) adjust the predicted results and input the adjusted results as new data; or ii) adjust the predicted data to retrain the model.

Abstract: The disclosure provides methods of analyzing an analyte of interest in a biological sample using fluorescent agents and macroconjugates which comprise a core containing a cross-linked polymer or protein, tags, specific binding members or fragments thereof, and optionally carrier proteins. Also provided are methods of analyzing two or more analytes of interest in a biological sample in a single assay using microparticles and detection conjugates comprising different fluorophore labels, acquiring transmitted light and fluorescent images of the microparticles, and using a customized image analysis process to analyze the acquired images.

Abstract: A computer-implemented method of interactive machine learning in which a user is provided with predicted results from a trained machine learning model. The user can take the predicted results and adjust the predicted data to retrain the model.

Abstract: A computer-implemented method of interactive machine learning in which a user is provided with predicted results from a trained machine learning model. The user can take the predicted results and adjust the predicted data to retrain the model.

Abstract: An electrode assembly short circuit identification method includes: during charging, according to preset sampling time points, sequentially acquiring a voltage of an electrode assembly at each of the sampling time points; judging whether the electrode assembly has a continuous voltage drop according to the voltage acquired at each of the sampling time points; and determining whether the electrode assembly has a short circuit according to a judgment result.

Abstract: This application relates to a liquid leak detection method and apparatus, a battery control unit, and a battery management system. The method includes: obtaining a gas concentration detection signal output separately by a plurality of target gas sensors in a battery box, where the gas concentration detection signal is used for indicating a measured gas concentration; obtaining position information of each target gas sensor in the battery box; and determining a leaking region in the battery box based on the gas concentration detection signal and the position information of each target gas sensor. To sum up, in an embodiment of this application, the leaking region in the battery box can be located by analyzing the gas concentration detection signals and position information of a plurality of target gas sensors in the battery box, so that prompt information used for indicating the leaking region can be output subsequently.

Abstract: A positive electrode sheet has a straight portion and to-be-bent portions, A thickening layer is disposed on at least one side of a positive electrode current collector of at least some of the to-be-bent portions, the thickening layer is disposed between the positive electrode current collector and a positive electrode active material layer, the positive electrode active material layer covers a surface of the thickening layer is a first positive electrode active material layer, and the positive electrode active material layer located in the straight portion is a second positive electrode active material layer. A ratio of a thickness of the first positive electrode active material layer to a thickness of the second positive electrode active material layer is 20-80%.

Abstract: The embodiments of the present disclosure relate to the field of battery technology, and provide a battery lithium plating detection method, device, management system, battery and electric device. The lithium plating detection method may include: charging a to-be-tested battery and stopping charging after the to-be-tested battery has been charged to a first state of charge (SOC), and allowing the to-be-tested battery to rest; obtaining a first voltage of the to-be-tested battery upon completion of electrochemical equilibrium; collecting a second voltage of the to-be-tested battery; and determining that lithium plating has occurred in the to-be-tested battery in case where a difference between the second voltage and the first voltage is greater than a first voltage threshold.