Abstract: The present application discloses a method, apparatus, device and medium for estimating performance parameters of a battery. The method for estimating performance parameters of a battery includes: generating a first curve segment to be calibrated during a process of adjusting a battery capacity in a first capacity interval with a first capacity value as an endpoint value; determining, in a preset reference curve, a first target curve segment that matches the first curve segment to be calibrated; determining a SOC interval corresponding to the first target curve segment as a SOC interval of the first curve segment to be calibrated; and estimating the performance parameters of the battery based on the SOC interval of the first curve segment to be calibrated, the performance parameters include a current SOC and/or a current battery capacity.

Abstract: Systems and methods for features engineering, in which internal and external signals are received and fused. The fusing is based on meta-data of each of the one or more internal signals and each of the one or more external signals. A set of features is generated based on one or more valid combinations that match a transformation input, the transformation forming part of library of transformations. Finally, a set of one or more features is selected from the plurality of features, based on a predictive strength of each feature. The set of selected features can be used to train and select a machine learning model.

Abstract: Systems and methods for dynamic demand sensing in a supply chain in which constantly-updated data is used to select a machine learning model or retrain a pre-selected machine learning model, for forecasting sales of a product at a specific location. The updated data includes product information and geographic information.

Abstract: A dynamic supply chain planning system for analysis of historical lead time data that uses machine learning algorithms to forecast future lead times based on historical lead time data, weather data and financial data related to locations and dates within the supply chain.

Abstract: A method for preparing amantadine includes chlorinating adamantane with chlorine gas in a solvent in the presence of a Lewis acid catalyst to obtain a reaction liquid, and then removing the solvent and residues containing the catalyst in the reaction liquid, to obtain a chlorinated product. The chlorinated product is mixed with urea to a mixture, and the mixture is subjected to an amination reaction, to obtain amantadine. The results of examples show that the purity of the prepared amantadine could reach 99.5% or more.

Abstract: A dynamic supply chain planning system for analysis of historical lead time data that uses machine learning algorithms to forecast future lead times based on historical lead time data, weather data and financial data related to locations and dates within the supply chain.

Abstract: Systems and methods for embedding a computational notebook within an enterprise application software. A computational notebook editor embedded is embedded within a software client interface which is in communication with the software client interface. The application server comprises a reverse proxy server that is embedded within the application server. A container management system is in communication with the application server and comprises a multi-user server, a notebook interactive development environment, and a notebook execution tool.

Abstract: An optical element driving mechanism is provided. The optical element driving mechanism includes a fixed portion, a movable portion, a driving assembly, and a circuit unit. The movable portion is movably connected to the fixed portion, and holds an optical element. The driving assembly drives the movable portion to move relative to the fixed portion. The circuit unit includes a base, a plate-connecting portion, and a layer-connecting portion. The plate-connecting portion is partially embedded in the base. The layer-connecting portion is disposed on the base. The driving assembly is electrically connected to the layer-connecting portion. The thickness of the plate-connecting portion is different from the thickness of the layer-connecting portion.

Abstract: An optical element driving mechanism is provided. The optical element driving mechanism includes a fixed portion, a movable portion, a driving assembly, a first circuit assembly, and a second circuit assembly. The fixed portion includes a housing, a frame, and a base. The frame is affixed to the housing. The base is fixedly connected to the housing. The movable portion is movably connected to the fixed portion, and carries an optical element, wherein the optical element has an optical axis. The driving assembly drives the movable portion to move relative to the fixed portion. The first circuit assembly is disposed in the frame, and electrically connected to the driving assembly. The second circuit assembly is disposed on the base.

Abstract: The present application discloses a method, apparatus, device and medium for estimating performance parameters of a battery. The method for estimating performance parameters of a battery includes: generating a first curve segment to be calibrated during a process of adjusting a battery capacity in a first capacity interval with a first capacity value as an endpoint value; determining, in a preset reference curve, a first target curve segment that matches the first curve segment to be calibrated; determining a SOC interval corresponding to the first target curve segment as a SOC interval of the first curve segment to be calibrated; and estimating the performance parameters of the battery based on the SOC interval of the first curve segment to be calibrated, the performance parameters include a current SOC and/or a current battery capacity.

Abstract: A sewage discharge device detachably and hermetically connected to a sewage tank includes a drain pipe and a main box body. A drain control valve and a self-priming drain pump are provided inside the main box body. One end of the drain control valve is detachably and hermetically connected to the drain pipe. The other end of the drain control valve is detachably and hermetically connected to the self-priming drain pump. The self-priming drain pump is provided with a drain nozzle and a cleaning coupling. The drain nozzle is detachably and hermetically connected to a sewage pipe. The drain nozzle and the cleaning coupling protrude outside the main box body. The sewage discharge device of the present invention prevents users from contacting fecal matter and wastewater. Manual cleaning of the drain pipe is also eliminated, which is convenient to use.

Abstract: Disclosed is a specific communication emitter identification method based on an instantaneous envelope equipotential constellation trace figure, including: selecting a specific communication emitter and acquiring its radio frequency signal fragment, performing instantaneous envelope extraction to the radio frequency fragment, and representing the instantaneous envelope with a constellation trace figure using a constellation trace figure two-dimensional visualization method, wherein the constellation trace figure serves as a radio frequency fingerprint of a transmitter, and inputting the radio frequency fingerprint into a classifier to identify. The disclosure overcomes drawbacks in conventional technologies.

Abstract: A method and system for a machine learning duster analysis of historical lead time data, which is augmented by one or more features. The data can also be divided into groups, based on time-density of the data, with clustering performed on each group. Furthermore, clustering can also be projected onto two dimensions. In addition, the historical lead time data is separated into a plurality of tolerance zones based on tolerance criteria. The clusters are separated in accordance with a tolerance zone of each group; and further separated according to one or more lead time identifiers to provide one or more separated clusters.

Abstract: A horizontal automatic submersible pump includes a capacitive liquid level sensor, a circuit board and a motor. The capacitive liquid level sensor is arranged inside a casing of the horizontal automatic submersible pump. The capacitive liquid level sensor is configured to detect a liquid level outside the casing of the horizontal automatic submersible pump. The output terminal of the capacitive liquid level sensor is connected to the input terminal of the circuit board. The control terminal of the motor is connected to the output terminal of the circuit board. The circuit board is configured to control the motor to work or stop according to a detection signal of the capacitive liquid level sensor. The horizontal automatic submersible pump starts and stops automatically, and the capacitive liquid level sensor means there are fewer moving parts, which makes the pump less expensive to manufacture, more dependable and longer lasting.

Abstract: An optical element driving mechanism is provided. The optical element driving mechanism has a main axis, and includes a fixed portion, a movable portion, and a driving assembly. The fixed portion includes a housing, a base, and a frame. The base is fixedly connected to the housing along the main axis. The frame is disposed in the housing, and has a plurality of protruding columns extending along the main axis. The protruding columns have a first section and a second section, and the first section is closer to the base than the second section. The movable portion is movable relative to the fixed portion, and carries an optical element. The shortest distance between the first section and the movable portion is longer than the shortest distance between the second section and the movable portion. The driving assembly drives the movable portion to move relative to the fixed portion.

Abstract: Systems and methods for obtaining product information via a conversational user interface. The communication channel receives communication from a user, the intent and entities of which are deduced by the NLP. These are communicated by the fulfillment API to the knowledge engine which retrieves information that fulfills the intent. The information is communicated to the fulfillment API, which converts the intent into a response, which in turn is forwarded by the NLP to the communication channel, and back to the user.

Abstract: A horizontal automatic submersible pump includes a capacitive liquid level sensor, a circuit board and a motor. The capacitive liquid level sensor is arranged inside a casing of the horizontal automatic submersible pump. The capacitive liquid level sensor is configured to detect a liquid level outside the casing of the horizontal automatic submersible pump. The output terminal of the capacitive liquid level sensor is connected to the input terminal of the circuit board. The control terminal of the motor is connected to the output terminal of the circuit board. The circuit board is configured to control the motor to work or stop according to a detection signal of the capacitive liquid level sensor. The horizontal automatic submersible pump starts and stops automatically, and the capacitive liquid level sensor means there are fewer moving parts, which makes the pump less expensive to manufacture, more dependable and longer lasting.

Abstract: A sewage discharge device detachably and hermetically connected to a sewage tank includes a drain pipe and a main box body. A drain control valve and a self-priming drain pump are provided inside the main box body. One end of the drain control valve is detachably and hermetically connected to the drain pipe. The other end of the drain control valve is detachably and hermetically connected to the self-priming drain pump. The self-priming drain pump is provided with a drain nozzle and a cleaning coupling. The drain nozzle is detachably and hermetically connected to a sewage pipe. The drain nozzle and the cleaning coupling protrude outside the main box body. The sewage discharge device of the present invention prevents users from contacting fecal matter and wastewater. Manual cleaning of the drain pipe is also eliminated, which is convenient to use.

Abstract: The present invention relates to a cyclic peptide from a novel bone morphogenetic protein 2 (BMP2), a preparation method therefor and an application thereof. The cyclic peptide from the novel BMP2 is selected from one of the following cyclized polypeptides: 1. a cyclized polypeptide having the sequence of CKIPKASSVPTELSAISMLYLGPGGDWIVAC; and 2. a cyclized polypeptide of which the sequence has an 80% homology with the sequence defined in item 1. The present invention also relates to a preparation method for the cyclic peptide from the novel BMP2, and an application thereof in the preparation of the composite material for promoting the repair of large-sized bone defects.

Abstract: A method and system for a machine learning cluster analysis of historical lead time data, which is augmented by one or more features. The data can also be divided into groups, based on time-density of the data, with clustering performed on each group. Furthermore, clustering can also be projected onto two dimensions. In addition, the historical lead time data is separated into a plurality of tolerance zones based on tolerance criteria. The clusters are separated in accordance with a tolerance zone of each group; and further separated according to one or more lead time identifiers to provide one or more separated clusters.